SecReT4
Protein ID: 330817367
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24920
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2873194..2874192 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF2LFF0
KEGG IDbgd:bgla_1g24920
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.1e-66, Aligned region: 106..325
Protein Sequence: 332 a.a.     [Download]
>gi|330817367|ref|YP_004361072.1| P-type conjugative transfer protein TrbG [Burkholderia gladioli BSR3]
MSLHFRIYAFVLTVAATSSLLGCASQGKPPPHISLDEPVQAQQQPEPPKPVEVVEVPKVLPMPAQMKPLP
SGDDAKPASEPADETERVSRANAEARMAPTREGFVNAIQVWPFSDGALYQVYAAPGRVTVISLQPGEELV
TVAAGDTVRWIVGDTSSGAGNDLRVNVLVKPIRSGLKTNLVITTSRRTYLIELTSTDKAWMASASWEYPK
DQMLALQRQDQAAQAAAPVDFGLSLEKIRFRYAISGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLF
VIGSQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDSTRGN
 
Nucleotide Sequence: 999 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2874192-2873194 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGCCTGCATTTCCGTATCTACGCTTTCGTGCTGACCGTGGCGGCCACGTCGTCACTGCTGGGCTGCG
CCTCGCAGGGCAAGCCGCCGCCGCATATCTCGCTCGACGAGCCGGTGCAGGCGCAGCAGCAGCCTGAACC
GCCCAAGCCGGTCGAAGTGGTCGAAGTACCGAAAGTGCTGCCGATGCCAGCGCAGATGAAGCCGCTGCCG
TCTGGCGACGATGCCAAGCCTGCGTCGGAACCGGCCGACGAAACCGAGCGCGTTTCGCGCGCCAACGCCG
AGGCGCGCATGGCTCCCACGCGTGAGGGCTTCGTCAACGCGATTCAGGTGTGGCCCTTCAGCGACGGAGC
GCTATATCAGGTCTATGCCGCGCCGGGGCGTGTCACCGTGATTTCGCTCCAGCCAGGCGAAGAACTGGTG
ACGGTCGCCGCCGGCGACACCGTGCGATGGATCGTCGGCGACACGTCCAGCGGGGCCGGCAACGATCTGC
GCGTCAACGTGCTGGTGAAGCCGATTCGCTCGGGCCTCAAGACAAATCTCGTCATCACCACCAGCCGGCG
TACCTATCTGATCGAGTTGACCTCGACGGACAAGGCGTGGATGGCGTCGGCATCGTGGGAGTATCCGAAA
GACCAGATGCTGGCCTTGCAGCGTCAGGATCAGGCCGCGCAGGCAGCCGCGCCTGTCGATTTCGGCCTGT
CGCTGGAGAAGATCCGCTTCCGCTACGCGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGCCTT
CGACGACGGCGAGAAGGTCTATATCCAGTTCCCGCCGGGCATCGCACAAGGCGAACTACCGCCGCTGTTC
GTCATCGGCTCGCAGGGCGACGGCCAGCTCGTCAACTACCGTTTCCGTTCGCCGTACTACATCGTAGATC
GGCTGTTCGGCGCGGCCGAACTACGCCTGGGTGGTGACAAGGGCGACGTGGTGCGTATCGAGCGCACGGA
CAGCACGCGGGGGAACTGA
 Primer design