SecReT4
Protein ID: 330817368
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24930
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2874189..2874896 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDF2LFF1
KEGG IDbgd:bgla_1g24930
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.6e-59, Aligned region: 23..226
Protein Sequence: 235 a.a.     [Download]
>gi|330817368|ref|YP_004361073.1| conjugal transfer protein TrbF [Burkholderia gladioli BSR3]
MRFKRPQVRYANTPQPATPYQSAAQVWDERIGSARVQAKNWRFMAFGCLALALLMAGGLVWRSTQSMVTP
YVVQVNNAGDVLAVGEAETSYNPKDADIAKFLENFIKLTRSLSIDPIVVRQNWLEAYNYTTDRGATVLNE
YASKSDPFARVGKESVTVEVVSVVRVSDTSFNVRWNEQHYVNGAAAAKPEHWTAAITLVHQTPHTEERVR
KNPLGLYVHGLSWSRDLDVSEGAKP
 
Nucleotide Sequence: 708 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2874896-2874189 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGCGATTCAAGCGACCGCAGGTGCGCTACGCCAATACGCCGCAGCCTGCCACCCCATATCAATCCGCCG
CGCAGGTGTGGGACGAGCGTATCGGCTCGGCCCGCGTACAGGCGAAGAACTGGCGCTTCATGGCCTTCGG
CTGCCTCGCGCTCGCGCTGCTGATGGCGGGCGGCCTGGTGTGGCGCTCAACGCAGTCGATGGTCACGCCT
TACGTCGTGCAGGTGAACAACGCTGGTGACGTGTTGGCCGTTGGCGAAGCCGAGACTTCGTACAACCCCA
AGGACGCGGACATTGCGAAGTTCCTGGAGAACTTCATCAAGCTGACTCGCTCGCTTTCCATCGACCCGAT
TGTTGTCCGCCAGAACTGGCTCGAAGCCTACAACTACACCACCGATCGTGGTGCGACCGTCCTCAACGAG
TACGCGAGCAAGAGCGATCCCTTCGCGCGCGTCGGCAAGGAGTCAGTGACGGTCGAAGTCGTCAGTGTGG
TTCGCGTGAGCGATACCTCGTTCAACGTGCGCTGGAACGAACAGCACTACGTCAACGGTGCGGCAGCGGC
CAAACCCGAGCACTGGACGGCGGCCATCACGCTTGTCCACCAAACCCCGCACACGGAAGAACGGGTGCGG
AAGAACCCCCTGGGCCTCTACGTGCATGGCTTGTCGTGGAGCCGTGATCTGGACGTGTCCGAAGGAGCCA
AGCCATGA
 Primer design