SecReT4
Protein ID: 330817369
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24940
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2874920..2876296 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDF2LFF2
KEGG IDbgd:bgla_1g24940
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.7e-47, Aligned region: 37..264
Protein Sequence: 458 a.a.     [Download]
>gi|330817369|ref|YP_004361074.1| TrbL/VirB6 plasmid conjugal transfer protein [Burkholderia gladioli BSR3]
MNDVSIIDHFLNVFSTYIDSGFGLLHGEVAFLTATLVVIDMTLAGLYWALGHATGQGEDVMAKLIRKVLY
VGAFAYIIENFNMLSGVVFRSFAGLGLTATGSAVSMETFLQPGHLAKTGIDAAAPILDQISQMAGFPEVF
INITPIVVMFLAWFTVIVCFFVLAVQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGTGLFAEFPTTPNDPSIDHALVVMLASLAMLALGIYGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGVGGAVVAGARMAPAAATALGKGARMAASTASSAGSAFQAGSAAAGGGAKGAMAG
FGNVAKTGAQAVGQKAAAGARSFGQRAAAAFRSDSAGASSGGASSGAASDQAATDTSVNSTDQPQPAWAK
RLHRRQQITHAATTAAHTLHGGDGGGSAQGPSLGQSDE
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2876296-2874920 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAACGACGTTTCAATCATCGACCACTTCCTCAATGTCTTTTCCACCTACATCGACAGCGGATTCGGCC
TGCTGCATGGTGAGGTCGCGTTTCTGACCGCGACGCTGGTGGTGATCGACATGACGCTTGCCGGTCTGTA
TTGGGCGCTCGGACACGCGACCGGTCAGGGCGAAGACGTAATGGCGAAGCTCATCCGCAAGGTGCTCTAC
GTCGGCGCGTTCGCCTACATCATCGAGAACTTCAACATGCTGTCCGGCGTCGTGTTCCGTTCGTTCGCCG
GCCTGGGCCTGACGGCCACCGGCTCGGCCGTGAGCATGGAGACGTTCCTGCAACCGGGGCATCTCGCCAA
GACCGGCATCGACGCTGCCGCGCCGATTCTCGATCAGATCAGCCAGATGGCCGGTTTCCCCGAGGTGTTC
ATCAACATCACGCCCATCGTCGTGATGTTCCTCGCGTGGTTCACCGTCATCGTCTGCTTTTTCGTGCTGG
CGGTACAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGCTTCGTGCTGGTGCCGTT
CGCGCTCTGGAACAAGACCGCGTTCCTTGCCGAAAAAGTGCTCGGCAACGTGGTGTCGTCGGGCATCAAG
GTACTGGTACTGGCTGTCATCGTCGGCATCGGCACGGGCTTGTTCGCGGAGTTCCCCACGACGCCGAATG
ATCCCTCCATCGACCACGCGCTGGTCGTGATGCTGGCCTCGCTGGCGATGCTCGCGCTCGGTATCTACGG
GCCGGGCATTGCGACCGGCCTTGTATCCGGTGCGCCGCAGCTCGGCGCGGGTGCGATGGCCGGTGCTGCC
GTCGGAGCGGCCGGCACTGCTGTCGCTATCGGCGCTGCCGCTACCGGCGTCGGCGGTGCCGTGGTCGCCG
GTGCGCGTATGGCGCCTGCCGCCGCCACTGCGCTCGGCAAGGGCGCACGCATGGCCGCCTCTACGGCCAG
CAGTGCCGGCTCGGCCTTTCAGGCCGGTTCCGCTGCCGCCGGTGGCGGCGCGAAAGGCGCGATGGCCGGA
TTCGGGAATGTCGCCAAAACGGGCGCGCAGGCCGTCGGCCAGAAGGCCGCCGCTGGCGCGCGCTCATTCG
GACAACGTGCCGCCGCAGCCTTCCGTTCGGATAGCGCAGGCGCATCCAGCGGCGGTGCTTCATCCGGTGC
CGCATCCGACCAGGCTGCCACCGATACCTCTGTCAATTCCACCGACCAGCCGCAACCCGCCTGGGCCAAG
AGGCTGCACCGCCGCCAGCAGATCACCCATGCCGCCACGACCGCCGCGCACACGCTACACGGCGGGGACG
GTGGCGGCTCGGCGCAAGGCCCGAGCCTGGGCCAATCCGACGAATGA
 Primer design