SecReT4
Protein ID: 330817370
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24950
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2876308..2877036 [-]
ProductP-type conjugative transfer protein TrbJ
Component typeTrbJ
UniProt IDF2LFF3
KEGG IDbgd:bgla_1g24950
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 2e-06, Aligned region: 5..41
Protein Sequence: 242 a.a.     [Download]
>gi|330817370|ref|YP_004361075.1| P-type conjugative transfer protein TrbJ [Burkholderia gladioli BSR3]
MKIRLLALAVAAFVGVMPAAHAQWAVIDSTNLVQNTLTAVRTMQMIENQINQLQNQAQMLVNQSRNLASL
PFNVVSRLQSNLATTQQLITQAQGLAFQVQSMDQQFAQLYPQQYAATVSGNQMYQDAHQRWQNTLTGLQT
AMQMQAQVSQNVTIDQGVLTDLVGQSQSATGALQAQQATNQLLALQAKQSIQAQQLQLTQGRAASLELAR
QAAAVEQGRVITQRFLGTGTPYTPQAVSFYGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2877036-2876308 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAAGATCCGTCTTCTTGCCCTTGCTGTCGCGGCATTCGTCGGCGTCATGCCGGCAGCGCACGCGCAAT
GGGCCGTCATCGACTCGACCAACCTCGTGCAGAACACGCTGACGGCGGTTCGCACGATGCAGATGATCGA
AAACCAGATCAACCAGCTCCAGAACCAGGCGCAGATGCTGGTCAATCAGAGCCGCAATCTGGCGAGCCTG
CCGTTCAACGTGGTCAGTCGCCTGCAATCGAATCTGGCGACCACGCAGCAGCTCATCACGCAGGCGCAGG
GACTGGCGTTCCAGGTGCAGAGCATGGATCAGCAGTTCGCGCAGTTGTACCCGCAGCAGTATGCCGCGAC
CGTGAGCGGCAACCAGATGTACCAGGACGCGCACCAGCGTTGGCAGAACACGCTTACTGGCTTGCAGACC
GCGATGCAGATGCAGGCGCAGGTGTCGCAGAACGTGACTATTGACCAAGGCGTGCTGACTGACCTTGTGG
GCCAGAGCCAGTCTGCGACCGGCGCGCTGCAAGCGCAGCAGGCGACGAACCAGCTTCTCGCGTTGCAGGC
CAAGCAGTCCATCCAGGCGCAGCAGCTGCAGCTCACTCAGGGACGCGCGGCGTCGCTGGAACTGGCACGT
CAGGCGGCGGCCGTTGAGCAGGGCCGCGTCATCACGCAGCGGTTTCTCGGCACCGGCACGCCGTACACGC
CGCAAGCCGTGAGCTTCTACGGGAACTGA
 Primer design