SecReT4
Protein ID: 330817371
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24960
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2877033..2879483 [-]
ProductATPase
Component typeTrbE
UniProt IDF2LFF4
KEGG IDbgd:bgla_1g24960
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.7e-36, Aligned region: 442..706
CagE_TrbE_VirB [PF03135], Evalue: 4e-14, Aligned region: 299..388
DUF853 [PF05872], Evalue: 1.1e-06, Aligned region: 613..684
Protein Sequence: 816 a.a.     [Download]
>gi|330817371|ref|YP_004361076.1| ATPase [Burkholderia gladioli BSR3]
MFNLAEYRQRPALLADWLPWAGLAARGVVLNKDGSFQRTARFRGPDLDSATQGELIATTARLNNALRRLG
AGWALFVEAERRPAANYPHSDFPEPLSWLVDEERRATFEESGNHFESGYHLTLQYLPPEESRARAAKLLY
ENTPTSGVDWRERLAAFVAETSRVFDLLDGVMPEIDWLDDAETLTYLHATISTRRFGLAVPEVPFHLDAL
LADVPLIGGLAPMLGDQHLRVVTVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCMDKAEAEKELGRLRRQ
WFAKRKNVLALLRETIFQQESPLVDTDASNKSADADAAMQELGSDQVAFGFVTATVAVLDADADTADEKL
RMVERVIQGRGFVTIPETLNSVEAWLSSVPGNAYANVRQPIVSTLNLAHLMPVSAVWAGPEKNAHLDGPP
LIVTRTDGVTPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYPGSRIFAFDMGRSMRATALGLG
GEYYDLGADGAIAFQPLARIDQEGYRTWAAEWVEGRLSHEGITVGPDEKAAIWSALGSLAGAPVEQRTLT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADHDRLGSAEVQCFEMEELMHSKAAVLAVLGYLFARFDERF
DGAPTLLILDESWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSTIAPAIIESCASRIFLPN
PQATEPQICVIYEGFGLNSRQIEIVATAQPKRDYYYQSRAGNRLFDLDLGPVTLAFAGASTPQDQRDIDR
VLTQAGAPGFAGAWLRHRGLDWAADLLPSAPSAASFLASQSQEIAP
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2879483-2877033 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGTTCAACCTCGCCGAATACCGTCAACGTCCAGCCTTGCTCGCCGACTGGCTCCCGTGGGCGGGACTCG
CCGCGCGCGGCGTCGTGCTCAACAAGGACGGTTCGTTCCAGCGTACCGCACGCTTTCGCGGCCCCGACCT
CGACAGCGCGACGCAGGGCGAGCTGATCGCCACGACCGCGCGCCTGAACAACGCGCTACGTCGGCTCGGT
GCCGGCTGGGCGCTATTCGTCGAAGCGGAGCGCCGGCCGGCAGCGAACTATCCGCACTCGGATTTCCCAG
AACCGCTGTCGTGGCTGGTGGACGAAGAACGCCGCGCGACCTTCGAGGAGTCGGGCAACCACTTCGAGAG
CGGCTATCACCTCACGCTGCAATACCTGCCGCCGGAGGAATCGCGCGCACGCGCCGCGAAACTCCTGTAC
GAAAACACGCCCACGTCCGGCGTGGACTGGCGCGAACGTCTGGCCGCGTTCGTCGCGGAAACCTCGCGTG
TCTTCGATCTGCTCGACGGCGTGATGCCGGAAATCGACTGGCTCGACGATGCCGAAACGCTTACCTACCT
GCACGCGACCATCTCGACGCGACGCTTTGGGCTGGCGGTGCCGGAGGTGCCATTCCATCTCGATGCGCTG
TTGGCCGACGTGCCGCTGATTGGTGGCTTGGCTCCGATGCTCGGCGACCAGCATCTGCGCGTGGTGACAG
TGCGCGGTTTCCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGGCTCGGCTTCGCGTACCG
CTGGAGCACGCGCTTTCTCTGCATGGACAAGGCCGAAGCCGAAAAGGAACTCGGCCGCCTGCGCCGCCAG
TGGTTTGCCAAGCGCAAGAATGTCCTCGCGCTGCTGCGTGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAGCAACAAGTCAGCCGACGCCGATGCCGCGATGCAGGAACTCGGCAGCGATCAAGT
CGCCTTCGGCTTCGTCACCGCGACCGTAGCGGTGCTCGATGCCGACGCCGACACGGCCGACGAGAAGCTG
CGCATGGTGGAGCGCGTGATTCAGGGCCGGGGCTTCGTGACCATTCCCGAAACCCTCAATTCGGTGGAGG
CATGGCTGTCGTCGGTGCCGGGCAACGCCTATGCGAACGTGCGTCAGCCCATCGTCTCGACGCTGAATCT
CGCGCACCTGATGCCGGTGTCGGCCGTGTGGGCCGGGCCGGAGAAGAACGCGCACCTCGACGGCCCGCCG
CTGATCGTCACGCGCACCGATGGCGTGACACCGTTCCGGCTGGTCACGCACATCGGCGACGTGGGCCACA
CCTTGGTCGCCGGCCCGACCGGCATGGGTAAATCCGTCCTGCTCGCCACGCTGGCGATGCAGTTCCGACG
CTATCCCGGCTCGCGCATCTTCGCCTTCGACATGGGCCGGTCGATGCGGGCAACGGCGCTGGGTCTCGGC
GGCGAGTATTACGACCTCGGCGCCGATGGCGCGATCGCGTTCCAGCCGCTCGCGCGCATCGACCAGGAAG
GCTATCGCACCTGGGCCGCCGAATGGGTTGAAGGACGCCTGTCCCATGAAGGCATCACCGTTGGCCCCGA
CGAGAAGGCGGCCATCTGGTCGGCGCTTGGCAGCCTCGCTGGTGCGCCGGTCGAACAGCGCACGCTCACG
GGGCTGTCGGTACTGCTGCAATCGAATGCGCTGCGGCAGGCGCTCGCGCCGTATGTGCTGGGTGGCGCGC
ACGGCAAGCTGCTCGATGCCGACCACGACCGGCTCGGCTCTGCCGAAGTGCAGTGCTTCGAGATGGAAGA
ACTGATGCACAGCAAGGCCGCCGTGCTGGCCGTGCTGGGTTATCTGTTCGCGCGCTTCGACGAGCGTTTC
GACGGCGCACCGACGCTGCTGATCCTCGATGAATCCTGGCTGTTCCTCGATGACCCGGTATTCGCCGCAC
GCATCCGCCAGTGGCTCAAGACGCTACGCAAGAAAAACGTGTCGGTGATCTTCGCCACGCAGTCGCTCGC
GGACATCAAGGATTCGACCATCGCGCCCGCGATCATCGAGAGCTGCGCGAGCCGCATCTTCCTGCCGAAC
CCGCAGGCCACCGAGCCGCAGATTTGCGTGATCTACGAAGGCTTCGGCCTCAACAGCCGGCAAATCGAGA
TCGTCGCTACCGCGCAGCCCAAGCGCGATTACTACTACCAGTCCCGCGCCGGCAATCGTCTGTTCGACCT
CGACCTGGGGCCGGTCACGCTCGCGTTCGCGGGCGCATCCACCCCGCAAGACCAGCGTGACATTGACCGC
GTGCTGACGCAGGCCGGCGCACCCGGCTTCGCCGGTGCGTGGCTGCGTCATCGCGGCCTCGATTGGGCGG
CCGACCTGCTGCCGTCCGCGCCATCTGCCGCGTCCTTCCTCGCTTCCCAATCCCAGGAGATTGCGCCATG
A
 Primer design