SecReT4
Protein ID: 330817372
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24970
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2879498..2879767 [-]
Productconjugal transfer protein trbD
Component typeTrbD
UniProt IDF2LFF5
KEGG IDbgd:bgla_1g24970
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8.2e-11, Aligned region: 1..82
Protein Sequence: 89 a.a.     [Download]
>gi|330817372|ref|YP_004361077.1| conjugal transfer protein trbD [Burkholderia gladioli BSR3]
MSTANDLPGFEVPLHRSLTEPILMGGAPRTVAIANGTLSGALGLGLQLWIPGVALWIVGHSLAVWGARVD
PQFMQVFARHLKHKPLLDV
 
Nucleotide Sequence: 270 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2879767-2879498 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGCACCGCCAACGACCTGCCGGGCTTCGAGGTGCCGCTGCATCGCTCGCTGACCGAGCCGATTCTGA
TGGGCGGTGCGCCGCGCACCGTAGCCATCGCCAACGGCACGCTCTCGGGTGCCCTGGGCCTCGGCCTGCA
ACTCTGGATTCCCGGTGTCGCGCTCTGGATCGTCGGCCACTCGCTCGCCGTGTGGGGCGCGCGCGTCGAT
CCGCAGTTCATGCAGGTGTTCGCCCGGCACCTCAAGCACAAGCCGCTGCTGGACGTGTGA
 Primer design