SecReT4
Protein ID: 330817373
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24980
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2879764..2880147 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDF2LFF6
KEGG IDbgd:bgla_1g24980
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.5e-23, Aligned region: 33..117
Protein Sequence: 127 a.a.     [Download]
>gi|330817373|ref|YP_004361078.1| conjugal transfer protein Trbc [Burkholderia gladioli BSR3]
MTQMHTHAFRISVNPVSTVARLRRLVGPAHYGLMLSAVMLMTAGTAKASGSSMPWETPLQSILESIQGPV
AKIVAVLIIISTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2880147-2879764 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGACGCAGATGCACACCCATGCTTTCCGTATTTCCGTAAATCCGGTTTCCACCGTTGCGCGCCTGCGCC
GCCTGGTCGGCCCGGCGCACTACGGCCTGATGCTGTCCGCCGTCATGCTGATGACGGCCGGTACGGCGAA
GGCATCTGGCTCGTCGATGCCGTGGGAAACGCCGCTGCAATCCATCCTCGAATCCATCCAGGGGCCGGTC
GCCAAGATCGTCGCGGTGCTCATCATCATCTCGACCGGCCTGGCGCTCGCCTTCGGCGACACGTCGGGAG
GTTTTCGCAAGCTCATCCAGATCGTGTTTGGGTTGAGCATCGCCTTCGCGGCGTCCTCGTTCTTCCTGTC
GTTCTTCTCGTTCTCCGGCGGGGCCGTCGTATGA
 Primer design