SecReT4
Protein ID: 330817374
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24990
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2880144..2881163 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDF2LFF7
KEGG IDbgd:bgla_1g24990
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.7e-83, Aligned region: 27..293
TrwB_AAD_bind [PF10412], Evalue: 2.1e-06, Aligned region: 149..186
FtsK_SpoIIIE [PF01580], Evalue: 1.4e-05, Aligned region: 148..218
Protein Sequence: 339 a.a.     [Download]
>gi|330817374|ref|YP_004361079.1| P-type conjugative transfer ATPase TrbB [Burkholderia gladioli BSR3]
MSTQPQSFASTSLDRRIRMLRTAMGPLIAAALEDPDVVEIMLNPDHTLWVDRLSSGRAPMGAELSEEDGE
RIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPASPGPAFALRKRAVGVIPLDRYVADGMMTDQQ
AAFLRDAVRERQNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRAGVVSM
TELVRATMRLRPDRVIVGEVRGGEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRAL
VAEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYRLTDALEPSLPELPFPSPDPAGELP
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2881163-2880144 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGCACGCAACCGCAGTCCTTCGCCAGCACGTCGCTCGACCGGCGCATCCGCATGTTGCGCACGGCGA
TGGGGCCGCTGATCGCCGCCGCGCTCGAAGACCCCGACGTGGTGGAAATCATGCTCAACCCCGACCACAC
CCTATGGGTCGATCGCCTGTCGTCGGGGCGCGCGCCGATGGGCGCGGAGCTGTCCGAGGAAGACGGCGAA
CGCATCATCCGCCTGGTCGCCGCGCATGTCGGCGCGGAAGTGCATCGTGGCCAGCCGCTCTTGACCGCCG
AGCTGCCGGAAACCGGCGAACGCTTCGAGGGCATCCTGCCGCCGGCGTCTCCCGGCCCGGCGTTCGCGCT
GCGCAAGCGCGCCGTGGGCGTGATCCCGCTCGATCGCTACGTCGCCGACGGCATGATGACCGACCAGCAG
GCGGCGTTTCTGCGCGACGCCGTGCGCGAGCGGCAGAACATCCTCATCGCGGGCGGCACCAGCACCGGCA
AGACCACGCTCGCCAATGCCTTGCTCGCGGAAATCGCTGCGACCGGCGACCGCGTACTGGTGCTCGAAGA
CACCGTAGAGCTGCAATGCGCGGCGCGCGATCACGTCCCGCTGCGCACGCGCGCGGGCGTCGTGTCGATG
ACCGAGCTCGTGCGCGCCACGATGCGCCTGCGCCCCGACCGCGTGATCGTCGGCGAGGTGCGCGGCGGCG
AGGCGCTGGATCTCATCAAGGTATGGGGCACGGGCCACCCCGGCGGCATCGCCACGATTCACGCCGGCTC
CGCGCTCGGCGCGCTGTTGCGCCTGGAGCAACTGATTCTCGAAGTGGCCGTGAATCCGCCGCGCGCGCTC
GTCGCCGAGGCGGTCAACGTCGTCATCCACATCGCCGGCCGCGGCCGCAAGCGCCGCATCGAGAGCATCG
CCCGTGTCGTTGGCTTCGACGGCGTGGGCTATCGCCTGACGGACGCGCTGGAGCCGTCGCTTCCCGAGCT
GCCTTTCCCGTCGCCTGACCCTGCTGGAGAACTGCCATGA
 Primer design