SecReT4
Protein ID: 330817387
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g25130
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2893268..2893870 [-]
Producthypothetical protein
Component typeTraF
UniProt IDF2LFH0
KEGG IDbgd:bgla_1g25130
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 8.6e-53, Aligned region: 54..195
Protein Sequence: 200 a.a.     [Download]
>gi|330817387|ref|YP_004361092.1| hypothetical protein bgla_1g25130 [Burkholderia gladioli BSR3]
MTAPNTTANAPIVPPLSRSRGRVRIVVATLAAVGFAALAWASFLPANMRPLPRLTYNPSDSVAVGWYRID
PRTDSLPRPLFVDSIVLVPLPAKAATLAAQRGYLPAGVPLLKPVAAIAPQQVCISGGIVRIDGVPSAAVL
RADRLGRPLPSWPQCRRLEPGELFLLSTTNPASFDSRYFGPVNANTVIGVAHPVWLETRQ
 
Nucleotide Sequence: 603 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2893870-2893268 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGACAGCCCCGAACACCACGGCCAACGCGCCCATCGTTCCGCCACTTTCCCGCTCGCGCGGTCGCGTTC
GCATCGTCGTGGCGACGCTGGCCGCCGTCGGCTTCGCTGCGCTGGCCTGGGCGTCCTTCCTGCCTGCCAA
CATGCGGCCGCTACCGCGCCTGACCTACAACCCGTCCGACAGCGTGGCGGTCGGCTGGTATCGCATCGAC
CCGCGCACCGACTCGCTGCCACGTCCGTTGTTCGTGGACAGCATCGTGCTGGTGCCGCTGCCGGCCAAGG
CTGCCACGCTCGCTGCGCAGCGCGGCTATCTGCCGGCTGGCGTTCCACTACTCAAGCCCGTGGCCGCCAT
CGCGCCGCAGCAGGTGTGCATTTCGGGCGGCATTGTCCGCATCGACGGCGTGCCTTCGGCCGCCGTGCTG
CGTGCCGACCGGCTGGGTCGACCGCTGCCATCGTGGCCGCAGTGTCGCCGCCTCGAACCAGGCGAGCTTT
TCCTGTTGAGCACGACCAATCCGGCGTCGTTCGACAGCCGGTATTTCGGCCCGGTCAATGCAAACACGGT
GATCGGTGTTGCGCATCCGGTCTGGCTGGAGACACGCCAATGA
 Primer design