SecReT4
Protein ID: 330818861
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0540
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]70554..73271 [-]
Productconjugal transfer protein TraN
Component typeTraN_F
UniProt IDF2LSF9
KEGG IDbgd:bgla_3p0540
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 7e-15, Aligned region: 196..276
TraN [PF06986], Evalue: 7e-15, Aligned region: 526..608
Protein Sequence: 905 a.a.     [Download]
>gi|330818861|ref|YP_004351078.1| conjugal transfer protein TraN [Burkholderia gladioli BSR3]
MSTASQWLRSRRQYRKRRQLFRRMVCAAVSVSLLFADVSIAYADSFSDGQNILLGSQGTTNFVGMGNGIA
TGTVNYGQGGQGNCDTTKGTVCANDVLPSSYGQGNLSQFTSQYGGTNNAGNVQSAGYQQQLNDKTAGASG
NGTTPTQWLDYSANQGASSRNFGTSIGSTASDNLTQISQGTDPSGSANTLAGIMPSCTSTTDASGNVHQS
CTGVVQCLGNSCYNPQAESNSDFGSFAAAAQIINGMKSGMVCAETGKAPSQANTCTPYETQVVTGYTQDP
NQPDCSTCTVPVYKTEDYCKETGKSVQITCNGGSPQDLDGVIPGDIPSGCQLYTPPPNTDSYPAQCTPTV
FVGEVNACSNYVGSGVGLTNDCCAQGAQSASALSLTSLIALSDMIPQVQQLKAQLAQQVESALSPLTNAV
KDIGSDLSDFAGQIEGGLSNMVSSGSVGAGFECMADGTGAGTEINAAASLSANGSSQGITSGIQQFVQNQ
LTNMVGQQTAQELMQAYQYFNYAMTAYTIAATIGGLATKCSTDELQMGVKQKNKECVTMPEYCATSGGFT
CLQYTTKACCYGSMISRVLAQQIKAQLNPGVANGGYGASDNPDCSGFSPQQLAQVDWSKVDLSEWLATLN
ETGYSLPQTASQVNAAESGSTSLTSYYEPGTAPTTNQVQNSVVRANQLTSGGVMEASRANATLTQPTCYT
DPTGIPTYSKAIEPTDVIKAEGAVQSDYGFDQITSCTPTAGAHCMQINLGKQGDNYLNDSCSRIWRQLYN
FNVLRPDLIVSARLMEVEWDDHIDIKINGQDVFTSPDFYTNAYFVPGGVCDLKTSWNALSAPGSGQTEWN
PPGLNPPGPPTFVDLTTQFQHGGMIDTETDLIVGGGGEGDAFIQIQYNDPPNQTPTNCISPPNPQ
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c73271-70554 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGAGCACGGCTTCCCAGTGGCTTCGGAGTCGTCGGCAGTATCGCAAACGTCGCCAGCTGTTTCGACGCA
TGGTGTGCGCAGCGGTCAGTGTCAGTCTGCTCTTCGCGGACGTGAGCATCGCCTATGCCGACTCGTTTTC
GGACGGGCAGAATATCCTGCTCGGTTCACAAGGCACGACCAATTTCGTCGGAATGGGCAACGGCATCGCT
ACCGGTACCGTCAACTACGGGCAGGGCGGCCAGGGAAACTGTGACACCACGAAGGGGACTGTCTGTGCGA
ACGATGTCCTACCGTCGAGCTACGGGCAAGGCAATCTGAGCCAGTTCACCTCGCAATACGGTGGTACGAA
CAACGCCGGCAACGTCCAGTCAGCCGGGTACCAGCAGCAGTTGAACGACAAGACGGCGGGAGCGAGCGGC
AATGGCACGACGCCGACGCAGTGGCTCGACTACTCGGCGAACCAGGGTGCAAGTTCGCGTAACTTCGGCA
CGTCGATCGGCTCCACTGCCTCGGACAACCTGACGCAGATCAGCCAAGGCACGGATCCGTCCGGCTCGGC
AAACACGCTCGCTGGCATCATGCCATCGTGCACGTCGACCACGGATGCCAGTGGCAACGTGCACCAAAGC
TGCACGGGCGTCGTGCAATGTCTCGGTAATAGCTGTTACAACCCGCAGGCCGAGTCCAATTCGGACTTCG
GCAGCTTTGCAGCCGCGGCCCAGATCATCAACGGTATGAAGAGCGGGATGGTCTGCGCGGAAACCGGTAA
GGCCCCAAGCCAGGCAAACACCTGTACGCCATACGAAACGCAGGTGGTGACCGGTTATACGCAAGACCCG
AATCAGCCGGATTGCTCGACCTGCACCGTACCCGTGTATAAGACCGAGGATTATTGTAAGGAAACCGGCA
AGTCCGTTCAGATCACATGCAATGGCGGTTCGCCACAAGATCTCGACGGCGTCATTCCGGGAGACATTCC
GTCGGGCTGTCAGCTCTATACACCACCACCGAATACCGATAGCTATCCAGCGCAGTGCACGCCGACCGTA
TTCGTTGGGGAAGTGAACGCATGCTCGAACTACGTTGGCTCTGGCGTGGGTCTGACTAACGACTGCTGCG
CGCAGGGGGCGCAATCGGCGAGCGCGCTGAGTCTGACGTCGTTGATCGCGCTCTCCGACATGATCCCGCA
GGTTCAGCAGCTGAAAGCACAGTTGGCCCAGCAGGTCGAGTCGGCACTGAGCCCACTGACTAATGCGGTC
AAGGACATCGGTTCCGACCTCAGTGACTTCGCGGGTCAAATTGAGGGGGGCTTATCGAACATGGTGTCAT
CGGGTTCCGTCGGGGCCGGCTTCGAATGTATGGCTGACGGCACAGGTGCTGGTACCGAAATCAACGCGGC
TGCGAGCCTTTCTGCAAACGGTAGCTCGCAGGGGATTACCTCGGGCATACAGCAATTCGTTCAAAATCAG
CTGACAAACATGGTCGGGCAGCAAACTGCCCAAGAGCTGATGCAGGCCTATCAATATTTCAACTACGCGA
TGACCGCATACACGATCGCCGCAACGATCGGCGGTCTGGCGACGAAGTGCTCGACGGACGAGCTGCAAAT
GGGCGTGAAGCAGAAGAACAAGGAGTGCGTCACGATGCCGGAGTACTGTGCGACGAGCGGCGGCTTTACC
TGTCTGCAGTACACGACCAAGGCCTGTTGCTATGGCTCGATGATTTCACGCGTGCTCGCGCAGCAGATCA
AAGCGCAGTTGAACCCGGGCGTGGCCAACGGCGGCTACGGCGCTTCGGATAACCCTGATTGCAGTGGTTT
CTCACCTCAGCAACTGGCTCAGGTCGACTGGAGCAAGGTAGATCTCTCCGAATGGCTCGCCACTCTAAAC
GAAACGGGCTACAGCCTGCCGCAGACCGCCTCGCAGGTCAATGCAGCCGAGTCGGGTTCTACGAGCCTCA
CGAGCTACTATGAGCCCGGTACGGCCCCGACCACGAATCAGGTACAGAACTCGGTGGTACGGGCCAATCA
GCTGACCTCTGGCGGCGTCATGGAGGCTTCGCGCGCAAACGCCACGCTCACGCAGCCGACCTGCTATACG
GACCCAACGGGTATCCCAACGTATTCCAAGGCAATTGAGCCGACCGACGTGATCAAGGCCGAAGGAGCCG
TGCAGTCCGATTACGGTTTCGACCAAATCACGAGCTGCACGCCGACCGCGGGTGCGCACTGCATGCAAAT
CAACCTCGGCAAGCAAGGTGACAACTATTTGAACGACTCGTGTTCGCGGATCTGGCGGCAACTCTACAAC
TTTAACGTGTTGCGGCCCGACCTGATCGTGAGCGCTCGCCTCATGGAGGTCGAGTGGGACGATCACATCG
ACATCAAGATCAACGGCCAGGACGTCTTCACGTCGCCTGACTTTTACACCAACGCCTATTTCGTGCCTGG
CGGGGTGTGCGATCTCAAGACGTCGTGGAACGCGCTGTCCGCGCCCGGGAGCGGACAGACGGAATGGAAC
CCACCAGGCTTGAATCCCCCCGGGCCGCCGACGTTCGTCGATCTTACGACTCAGTTCCAGCATGGCGGGA
TGATCGATACCGAGACGGACCTGATCGTGGGTGGTGGGGGCGAAGGGGATGCGTTTATCCAGATCCAGTA
CAACGATCCACCGAACCAAACGCCGACGAACTGTATTTCGCCGCCGAATCCTCAATAA
 Primer design