SecReT4
Protein ID: 330818862
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0550
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]73271..74632 [-]
Productconjugal transfer protein TraU
Component typeTraU_F
UniProt IDF2LSG0
KEGG IDbgd:bgla_3p0550
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.1e-36, Aligned region: 71..366
TraU [PF06834], Evalue: 2.1e-36, Aligned region: 412..450
Protein Sequence: 453 a.a.     [Download]
>gi|330818862|ref|YP_004351079.1| conjugal transfer protein TraU [Burkholderia gladioli BSR3]
MIHATLHSNADFDVGFNVHTRAGHMPRWIRTLLLCVTVVCASLLLPAKSAHAQATGITSLSCPDANIFSN
LFNGVCWSSMFPLRIAGVDLFSPADGIGAPYNATSHPFCECNGSVGHLPTVGFTVGFWMPDKLIETTRYP
YCSPTLGGISLTSSPPNGISTSGTLPGGVSNFGRPALGGEDDSSNPDEAGLRQFNMFEFPLLEILDLLNV
PCNPDGAIGLDFAASSEEIPGWDKPELANYMNPETAVFANPTAMLALPVSCALASSGLTPQTDDLMFWAM
GCWGDAFPLDGFGGQSDQVQDSSLVLARAMLMFSQTPGSSLANRTVGDDVVSGSCAPVFSPPLQKSAFKI
SMLFPVAEAGSGLPGAGGFGTNGQPASISSSLNNPANTGPGTSPVGTSAAGQVVDFSSVTNGRCAHRIGE
TTFRWGDWRTRPGTGEDQVYMIWRWVDCCVGVF
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c74632-73271 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGATCCACGCTACTCTGCATTCCAACGCCGATTTCGATGTGGGCTTCAACGTGCACACACGCGCGGGGC
ATATGCCGCGCTGGATCCGTACGTTGTTGCTGTGCGTGACCGTTGTCTGCGCCTCGCTGCTGCTGCCAGC
GAAGTCCGCGCATGCACAGGCGACTGGCATTACGAGCCTGTCTTGCCCTGACGCGAATATCTTCTCCAAT
CTGTTCAACGGCGTGTGCTGGTCGTCGATGTTCCCTCTGCGGATCGCCGGTGTCGATCTCTTCAGCCCGG
CCGATGGCATCGGGGCACCCTACAACGCCACGTCGCATCCGTTTTGCGAGTGTAATGGCTCGGTGGGCCA
TTTGCCGACGGTAGGTTTCACGGTTGGGTTCTGGATGCCGGACAAGCTGATCGAAACCACCCGCTATCCG
TATTGCTCGCCGACACTCGGGGGGATTTCGTTGACGAGCTCACCGCCGAACGGGATTTCGACAAGTGGAA
CTCTGCCCGGCGGGGTCAGCAACTTCGGACGGCCGGCGCTTGGGGGCGAGGATGACAGTTCAAATCCCGA
CGAGGCCGGGTTGCGGCAGTTCAACATGTTCGAATTTCCATTGCTCGAGATCCTCGATTTGCTGAACGTG
CCATGTAACCCGGATGGCGCAATCGGTCTAGACTTCGCGGCTTCCTCGGAAGAAATTCCTGGCTGGGACA
AGCCGGAACTTGCGAACTACATGAACCCGGAAACAGCGGTGTTCGCGAACCCGACGGCGATGCTTGCCCT
GCCGGTCAGTTGCGCGCTGGCAAGCTCCGGCCTCACGCCTCAAACCGATGATCTGATGTTCTGGGCGATG
GGTTGCTGGGGGGACGCCTTCCCGCTCGACGGCTTCGGCGGCCAATCCGACCAGGTGCAGGATTCCTCGC
TCGTGCTCGCCCGGGCTATGCTGATGTTCAGCCAGACGCCGGGCTCCTCGCTTGCCAACCGCACTGTCGG
TGACGACGTGGTGTCCGGCAGCTGCGCGCCGGTGTTCTCGCCTCCGTTGCAGAAATCCGCATTCAAGATT
TCGATGCTTTTCCCTGTGGCCGAAGCGGGTAGCGGGTTGCCGGGCGCGGGTGGATTCGGAACGAACGGCC
AGCCAGCGAGCATCAGTTCTTCGCTGAACAACCCGGCCAATACCGGGCCTGGTACATCGCCCGTAGGCAC
GTCGGCCGCGGGGCAGGTCGTCGACTTCAGCTCGGTGACCAATGGTCGGTGCGCTCACCGGATCGGTGAA
ACCACTTTCCGCTGGGGCGATTGGCGCACACGGCCCGGAACGGGCGAGGATCAGGTCTATATGATCTGGC
GCTGGGTGGATTGCTGCGTGGGGGTGTTCTGA
 Primer design