SecReT4
Protein ID: 330818863
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0560
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]74636..75850 [-]
ProductType-F conjugative transfer system pilin assembly protein TrbC
Component typeTraW_F
UniProt IDF2LSG1
KEGG IDbgd:bgla_3p0560
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 3.9e-22, Aligned region: 106..207
Protein Sequence: 404 a.a.     [Download]
>gi|330818863|ref|YP_004351080.1| Type-F conjugative transfer system pilin assembly protein TrbC [Burkholderia gladioli BSR3]
MTGFAAAVAMYALSNTEAHAQDVPAGAIDSGLAATLGAQRDALATNAKALLAPVLGQVPQLSQDVPPQVL
DAAQKLLDPSKKYVVQNLSAGQGNPDADSMASLKTVIFISESMPHATLQALFAQASGRKDVAFILRGWTP
PKFRELIGAIKKDMPKGKPEANVFIDPQAFEQYGVDIVPVTIHERSSNHHWYQITGEISVDGAIDQIEHG
HAGRVVGNTYPVAEPDILAVIRERMRRVDWNKQIKHAVDDARQAPFNGVEMPVSTKTASHLFDPSVTLSR
DVTNPANGQIIAARGTRINPLQMQAFPYTVIAFDPYDPLQLRWAAEVVKRNPNTLAYVTRNAMHSDGRAT
WDVIGTRTFTLDEKAASRFDIESVPTMVRQEGLSMRVSTYTPASLAAAVQHTGN
 
Nucleotide Sequence: 1215 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c75850-74636 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
CTGACTGGCTTCGCCGCGGCAGTTGCCATGTATGCGCTATCAAATACCGAGGCTCATGCGCAGGACGTGC
CGGCGGGCGCAATCGACTCGGGTCTGGCGGCGACGCTCGGCGCGCAGCGCGACGCGCTTGCCACCAATGC
GAAGGCGCTGCTCGCTCCGGTGCTCGGCCAGGTGCCCCAGTTGTCGCAAGATGTGCCGCCGCAGGTGCTC
GACGCCGCACAGAAGCTCCTCGATCCGTCGAAGAAATACGTCGTGCAGAACCTCTCAGCTGGGCAGGGCA
ACCCTGATGCCGATTCGATGGCCTCCCTCAAGACGGTCATCTTCATTTCCGAATCGATGCCGCACGCAAC
GCTGCAGGCGCTTTTTGCGCAGGCCTCTGGACGCAAGGATGTCGCCTTCATTTTGCGTGGCTGGACGCCG
CCGAAGTTCCGCGAGTTGATCGGCGCGATCAAAAAAGACATGCCCAAGGGTAAGCCCGAGGCCAACGTTT
TTATCGACCCGCAGGCGTTCGAGCAGTATGGCGTCGACATCGTGCCGGTCACGATCCACGAACGCAGCTC
GAATCACCACTGGTATCAGATCACGGGCGAGATTTCGGTTGACGGTGCCATCGACCAGATCGAACACGGC
CATGCCGGCCGTGTGGTCGGCAATACCTATCCGGTGGCCGAACCCGACATCCTCGCGGTCATTCGCGAGC
GCATGCGCCGCGTCGACTGGAACAAACAGATCAAGCATGCCGTGGACGATGCACGCCAAGCACCGTTCAA
CGGCGTAGAGATGCCGGTGTCGACGAAGACGGCAAGCCATCTATTTGATCCGAGCGTGACACTCTCGCGC
GATGTGACGAACCCGGCTAACGGCCAGATCATCGCTGCGCGAGGCACGCGCATCAATCCGCTGCAGATGC
AAGCGTTCCCGTATACGGTCATCGCCTTCGATCCGTACGACCCCTTGCAGCTGCGCTGGGCGGCAGAGGT
CGTGAAGCGCAACCCGAACACACTTGCCTATGTGACCCGCAACGCCATGCATTCGGACGGCCGCGCGACG
TGGGACGTGATCGGCACGCGTACCTTCACGCTCGACGAGAAGGCCGCGAGCCGCTTCGATATCGAGAGCG
TGCCCACCATGGTTCGCCAGGAAGGCCTGTCCATGCGCGTAAGTACGTACACCCCGGCTTCGCTCGCCGC
AGCCGTCCAGCATACCGGGAACTGA
 Primer design