SecReT4
Protein ID: 330818865
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0580
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]77119..79548 [-]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDF2LSG3
KEGG IDbgd:bgla_3p0580
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.4e-41, Aligned region: 445..721
TraC_F_IV [PF11130], Evalue: 6.7e-29, Aligned region: 27..249
Protein Sequence: 809 a.a.     [Download]
>gi|330818865|ref|YP_004351082.1| type-IV secretion system protein TraC [Burkholderia gladioli BSR3]
MSVIEKIQAMMERESPSDLLLPMAQNDGTIFLDNQRIGTMLQCSLLAGADTRTQDSLISLLNDTYPADIM
FQWVQMGVPDLREPLHQYQTRRADQDNPASQVARDLGQRRVDFMAHSCEQPVLPLVNEARTLDVRLYLAI
TIPFKGLPYPTDQEVSEFKDMRERIRGSLQGARMASVVISMPVYLAVMRRYFDMYGGWDYYYDENKLLRD
QIVPPRTRITPFRKWLRIAVPDRKKVFARMIAVNRFPKRTSLAVADMFAGDLDGIGTQIGLPYVLTTTVY
IPDQSALSSKFRAKHTLINNQAFGPMLKWVPILAAKKEGHDCLGASLDRRQQPVQTSTVLTLFGHSTREL
ERRTSKIVAFYNSIQTQAYGEQYINVPTFFNQLPLHPSEQSINQTRRFHTMAAEHAAQFLPILGDWQGYG
DGIVLHTRRMKLFFYDVFNKQLNPNFNWVLFAESGAGKSFLVQAMIRDYLSRGVRIYIIDKGQSHTKLVT
INGGQVIRFHRHSNICLNPFTKVVEIEDDIGMLSAIIGKMASPRSQLPDHFESRIMQAIMSVWADMGPDM
TPNDVYIWLNKQHEDEHAIELARRLFPFSERGPYGNWFNGVNNLDTNAPIVSIELKDLEDNEMLQEVVLL
QVMLTTQANMFKGDDNVEKMMIAEECGDLLKNYYFSKFAAAINSKVRKHRGSMGLIMQNLSQLYQSAFGA
EIAASAATKFIMQQQGEAIEQAKDQKWLDLPGGTFELLKGVQTVKGRGGYSEVAVHAPGGFGIARLVESR
FNQVLFETEGLEKTEILGAVERGEDVALAIDDFIARHDG
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c79548-77119 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGAGTGTCATCGAAAAAATTCAGGCCATGATGGAGCGGGAGTCGCCCTCCGACTTGTTGCTGCCCATGG
CGCAAAACGACGGGACGATCTTCCTCGACAATCAGCGCATCGGGACGATGCTGCAATGCTCCTTGCTGGC
TGGCGCGGATACGCGCACGCAGGACAGTCTCATCAGTCTGCTGAATGACACGTATCCAGCTGACATCATG
TTCCAGTGGGTCCAGATGGGTGTACCGGATCTGCGCGAACCCCTCCATCAGTATCAGACCCGTCGTGCGG
ATCAGGATAATCCGGCAAGCCAAGTAGCGCGCGATCTCGGGCAACGTCGGGTCGACTTCATGGCTCACAG
TTGTGAGCAGCCGGTATTGCCTCTCGTCAACGAGGCCCGCACACTCGACGTACGGCTGTATCTTGCGATT
ACGATCCCGTTCAAGGGTCTGCCGTATCCGACAGACCAAGAGGTATCCGAATTCAAGGACATGCGCGAGC
GGATTCGTGGCTCACTGCAAGGCGCACGCATGGCGAGCGTTGTTATATCGATGCCTGTCTATCTTGCCGT
GATGCGCCGGTACTTTGACATGTACGGCGGCTGGGACTACTACTACGACGAGAACAAGCTGTTGCGCGAT
CAGATTGTGCCGCCACGAACGCGTATCACGCCGTTTCGCAAATGGCTGCGTATTGCCGTGCCGGATCGCA
AAAAGGTCTTTGCACGCATGATTGCGGTCAATCGTTTCCCGAAGCGTACTTCGCTCGCAGTGGCCGACAT
GTTCGCTGGGGATCTCGACGGCATTGGCACGCAGATCGGCCTGCCATATGTGTTGACCACCACGGTCTAT
ATCCCGGATCAATCGGCGCTTTCGAGCAAATTCCGCGCGAAACACACGCTGATCAATAACCAGGCGTTCG
GCCCGATGCTCAAGTGGGTGCCGATTCTGGCTGCGAAGAAGGAAGGGCACGATTGCCTCGGCGCGTCGCT
CGATCGGCGTCAACAGCCGGTGCAGACGTCGACCGTGCTCACGCTGTTTGGTCATTCGACCCGCGAGCTG
GAGCGTCGAACTTCGAAGATTGTTGCGTTCTACAACAGCATTCAGACGCAGGCTTACGGCGAGCAGTACA
TCAACGTCCCGACATTCTTCAACCAACTGCCGCTGCACCCGTCGGAGCAGTCGATCAACCAGACTCGCCG
TTTCCACACGATGGCGGCCGAGCACGCGGCACAGTTCCTGCCAATTCTTGGCGACTGGCAGGGCTACGGC
GATGGGATCGTGCTACACACGCGTCGCATGAAGCTCTTTTTCTACGACGTTTTCAACAAGCAACTGAACC
CGAACTTCAACTGGGTGCTATTTGCCGAGTCGGGTGCGGGTAAGTCGTTCCTCGTGCAGGCCATGATTCG
CGATTACCTGTCGCGTGGCGTGCGGATCTACATCATCGACAAGGGGCAATCGCATACCAAGCTCGTCACG
ATCAACGGTGGGCAGGTCATTCGTTTCCACCGTCATTCGAACATCTGCCTGAACCCTTTCACGAAGGTCG
TCGAGATCGAGGACGATATCGGCATGCTGTCGGCCATCATCGGCAAGATGGCATCACCGCGGTCGCAACT
GCCCGATCACTTCGAGTCACGGATCATGCAAGCGATCATGAGCGTGTGGGCCGATATGGGCCCCGACATG
ACGCCGAACGACGTGTACATCTGGTTGAACAAACAGCACGAGGATGAGCATGCGATCGAGTTGGCCCGTC
GACTTTTCCCGTTCTCTGAGCGAGGCCCATACGGCAACTGGTTCAACGGCGTCAACAATCTGGATACGAA
CGCGCCAATTGTGTCGATCGAGCTAAAGGATCTTGAGGACAACGAGATGTTGCAAGAAGTCGTGTTGCTG
CAGGTGATGCTCACGACCCAAGCGAACATGTTCAAGGGCGACGACAACGTCGAGAAGATGATGATCGCCG
AAGAGTGCGGCGACTTGCTCAAGAACTACTACTTCTCAAAGTTTGCCGCAGCCATCAACTCGAAAGTGCG
TAAGCACCGCGGGTCGATGGGTCTCATCATGCAGAACCTCTCGCAGCTCTACCAATCGGCGTTCGGTGCG
GAAATCGCTGCCTCAGCTGCAACGAAATTCATCATGCAGCAGCAGGGTGAAGCGATCGAGCAGGCCAAGG
ACCAGAAGTGGCTGGATCTGCCCGGCGGCACGTTCGAGTTGCTCAAGGGTGTCCAGACTGTGAAGGGGCG
CGGTGGCTACTCGGAAGTCGCCGTGCATGCCCCAGGTGGCTTCGGGATCGCCCGTCTCGTCGAATCCCGC
TTCAATCAGGTGCTGTTCGAGACCGAAGGCCTCGAAAAGACCGAAATCCTTGGCGCTGTCGAGCGTGGCG
AAGACGTCGCGCTTGCCATCGATGACTTCATTGCCCGCCACGACGGATAA
 Primer design