SecReT4
Protein ID: 330818866
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0590
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]79868..80179 [-]
Producthypothetical protein
Component typeTraA_F
UniProt IDF2LSG4
KEGG IDbgd:bgla_3p0590
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 103 a.a.     [Download]
>gi|330818866|ref|YP_004351083.1| hypothetical protein bgla_3p0590 [Burkholderia gladioli BSR3]
MRGVARTLAGLRRDILNALVFSAILLPFAAFAGTDTTFNSVVTMVSGWLTGSLGQTLALSGFGVALGSGL
IRGSIMGVVSGLALALSATYGPTVLTGLFTATF
 
Nucleotide Sequence: 312 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c80179-79868 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
GTGCGTGGTGTTGCACGCACGCTTGCTGGCCTCCGCCGGGACATCCTCAACGCTCTCGTTTTCAGCGCGA
TCCTGCTGCCGTTCGCAGCGTTCGCTGGTACCGATACGACGTTCAACTCGGTTGTGACGATGGTGTCCGG
CTGGTTGACCGGCTCGCTCGGTCAAACGCTCGCACTGTCGGGCTTCGGCGTGGCACTCGGTTCGGGTCTG
ATCCGTGGTTCCATCATGGGCGTGGTGTCGGGTCTCGCGCTTGCGCTGTCGGCGACCTACGGCCCAACCG
TGCTGACTGGTCTCTTCACTGCGACTTTCTGA
 Primer design