SecReT4
Protein ID: 330818867
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0600
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]80496..81320 [-]
Productsex pilus assembly protein TraV
Component typeTraV_F
UniProt IDF2LSG5
KEGG IDbgd:bgla_3p0600
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.4e-17, Aligned region: 40..151
Protein Sequence: 274 a.a.     [Download]
>gi|330818867|ref|YP_004351084.1| sex pilus assembly protein TraV [Burkholderia gladioli BSR3]
MLNRFNRLVRAVRPSVIAAVAISLGGALSGCASMWSVGSTQYDCPGIPNGVVCKTPREVYEATNHRNALI
TMDDDGKQRGANSGMGNTAGDDRDGALGAHANVTLPQPIQQPLPILEPAKVMRIWVNSWIDQNGDLHYPG
LIFTEITARRWAVGNIVAGVEGQVLTPVQVDNNGSSVNAGATDAATGTDSHVVGKPDAVIQPYAKSDTGA
GSSGASSGPSIPGMPIPDASTSGGMGGGNSSPFSTNFSSSSGGANFRPTTNWNARGSMGNSGFN
 
Nucleotide Sequence: 825 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c81320-80496 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGCTCAATCGATTTAATCGCCTTGTGCGAGCAGTGCGCCCCAGTGTGATCGCTGCTGTCGCGATCTCAC
TCGGCGGGGCGCTCTCCGGATGCGCTTCGATGTGGAGTGTCGGCTCGACGCAATACGACTGCCCGGGTAT
TCCGAACGGCGTGGTCTGCAAGACCCCACGTGAAGTCTACGAGGCGACGAACCATCGCAACGCGCTCATC
ACGATGGACGACGACGGCAAGCAACGCGGAGCCAATAGCGGCATGGGCAACACGGCAGGGGATGATCGCG
ATGGCGCGCTCGGTGCGCATGCGAATGTGACGTTGCCACAGCCGATCCAGCAACCGCTGCCGATTCTTGA
GCCGGCCAAAGTGATGCGGATCTGGGTCAATTCGTGGATCGATCAGAACGGCGACCTGCATTATCCGGGC
CTCATCTTTACTGAGATCACGGCTCGCCGCTGGGCAGTCGGCAACATTGTCGCAGGCGTGGAAGGCCAGG
TGCTCACGCCGGTTCAAGTCGACAACAACGGCTCGAGCGTCAACGCGGGGGCAACTGACGCGGCAACCGG
TACCGATTCGCACGTGGTCGGAAAGCCGGATGCAGTGATCCAGCCGTACGCCAAGTCCGATACCGGTGCG
GGAAGTTCGGGTGCGTCGTCGGGCCCGAGCATCCCCGGCATGCCGATTCCGGATGCATCGACGAGCGGCG
GTATGGGTGGGGGTAATAGCTCACCGTTCTCGACGAACTTTTCGAGCAGCTCGGGCGGTGCCAATTTCCG
TCCGACGACGAATTGGAACGCCCGCGGAAGTATGGGAAATAGCGGCTTCAATTGA
 Primer design