SecReT4
Protein ID: 330818868
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0610
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]81339..82697 [-]
Productsex pilus assembly protein TraB
Component typeTraB_F
UniProt IDF2LSG6
KEGG IDbgd:bgla_3p0610
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-41, Aligned region: 243..447
Protein Sequence: 452 a.a.     [Download]
>gi|330818868|ref|YP_004351085.1| sex pilus assembly protein TraB [Burkholderia gladioli BSR3]
MKLLDNLIRSWKLADADKRKRMMVGAASVGIIAGFFLMSKASHKPPPSQDTTLDTTVVEPPKRNVDLETL
NATLTSVQRQMQDSTVHLNNLDQQMQQVQSNLMNRINDVASGKMTDKNLQQHIDDTITKEVATEVAKQHP
MGQPGLVSVPGMPGSNLNPASTDPSYPTLPLGPGGADASKPGGDTPAKPALQLSDDDSGDSANGANGASD
AAGGSAAPLHISPNASDADRATAANTSHKQETWLPAGALFSGVLINGMDAPASQASQRQPTPVLIRVKKD
AILPNYYTADIKECFVLASGYGSMSSERAYMRTERLSCIRNDGGVIETALDGYITGEDGKVGMRGRLVSK
EGAVIARTLAAGFIGAFGQGLSTGLSGASQYGGGLTISSQQQIPMSTVIRDSAGAGIGNAFDRVAEFYLD
IAKEMVPVVEVDAGREADIILVHGVSLKLGQH
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c82697-81339 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGAAACTGCTCGATAACCTCATTCGCTCATGGAAGCTGGCTGACGCGGACAAGCGCAAGCGCATGATGG
TGGGCGCAGCATCGGTCGGCATCATTGCGGGCTTTTTCCTGATGTCGAAAGCCTCCCATAAACCGCCACC
TTCGCAGGACACGACGCTCGACACCACGGTGGTCGAACCGCCCAAGCGAAACGTCGACCTCGAGACCCTG
AACGCAACGCTGACTAGCGTGCAGCGCCAGATGCAGGATTCGACAGTCCACCTGAACAACCTCGACCAGC
AGATGCAGCAGGTGCAGTCGAACCTGATGAACCGCATCAACGACGTGGCGTCGGGGAAGATGACCGACAA
GAACCTGCAGCAGCACATCGACGACACGATTACGAAGGAAGTGGCAACTGAGGTGGCCAAGCAACATCCG
ATGGGTCAGCCTGGCCTCGTGTCCGTTCCGGGTATGCCCGGCTCGAACCTGAACCCGGCCTCGACCGACC
CCAGCTACCCGACGTTGCCGCTGGGCCCGGGAGGCGCAGACGCGTCGAAGCCGGGTGGCGACACGCCGGC
CAAACCCGCGCTGCAACTGTCGGACGACGATTCCGGCGATTCGGCGAACGGGGCGAATGGTGCAAGCGAT
GCGGCGGGCGGGTCGGCTGCACCGCTACATATCTCGCCGAATGCCTCGGACGCTGACCGCGCAACGGCCG
CAAACACCAGCCATAAACAGGAAACGTGGCTCCCCGCTGGCGCGCTTTTTTCGGGCGTGCTCATCAACGG
TATGGACGCTCCGGCGTCGCAGGCATCGCAGCGTCAGCCGACGCCGGTACTGATCCGCGTGAAAAAGGAC
GCCATTCTGCCGAATTACTACACCGCAGACATCAAGGAATGTTTCGTCCTTGCGAGTGGCTACGGTTCGA
TGTCGTCGGAACGTGCGTACATGCGTACCGAGCGCTTGTCGTGCATTCGTAACGACGGTGGAGTGATCGA
AACGGCACTCGACGGGTACATCACGGGTGAAGACGGCAAGGTTGGCATGCGCGGCAGGCTGGTGTCGAAG
GAAGGTGCAGTGATCGCACGCACGCTCGCCGCTGGATTTATTGGTGCATTCGGCCAAGGCCTGTCGACGG
GGCTATCCGGTGCGTCGCAGTACGGTGGTGGCCTCACGATCAGTTCCCAGCAGCAAATTCCGATGTCGAC
GGTCATTCGCGATTCGGCCGGAGCAGGTATCGGCAACGCATTCGATCGCGTCGCCGAGTTCTACCTGGAC
ATCGCGAAGGAAATGGTACCCGTAGTCGAAGTCGACGCTGGCCGGGAAGCCGACATCATCCTCGTGCATG
GCGTGAGCCTGAAGCTCGGCCAACATTAA
 Primer design