SecReT4
Protein ID: 330818869
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0620
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]82694..83956 [-]
Productsex pilus assembly protein TraK
Component typeTraK_F
UniProt IDF2LSG7
KEGG IDbgd:bgla_3p0620
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 5.8e-26, Aligned region: 183..401
Protein Sequence: 420 a.a.     [Download]
>gi|330818869|ref|YP_004351086.1| sex pilus assembly protein TraK [Burkholderia gladioli BSR3]
MIQVSNMRLLAASLALVAGGISLTAGAQNIPDGARIGASPNQPLPPITVPSSGSAAPAALPSSTIPASLS
TANRRTAVVTSGPLGRAPAQPSVPAGKSGIVSAPDAATAAATATANGASGVGHLPAAVHTRGHVRQLSHQ
LDAPAGGRQIDAATAYAALNTKQAPTTPLDSPLPGLGMAPGSEKPVDPVVIHCRPGENAMIPVAENFPNR
FDTPFVDPHVIDTKGDDSNMRVANSVFLTATRTTPFAIWIVDGKAGSQMCSLTLIPQNIPAQNLVLQMEG
AMRGDPAKAFAPGAQSEETGREDQYTIGLRTLMRTVARGIAPRGFSEERLDVGMAVSNGIAATPEHLYAG
SHYDIYIYRLTNKSRAPVTLSEEAFGTKGVRAVAFNPYIILPPGQSTEVYIIADRPDADASDSEAEVGLQ
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c83956-82694 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
GTGATTCAAGTATCGAATATGCGTTTGCTCGCGGCTTCGCTCGCCCTGGTTGCAGGCGGGATCAGTCTCA
CGGCAGGTGCGCAGAATATCCCGGATGGTGCCCGCATCGGCGCATCGCCAAACCAGCCGCTTCCGCCGAT
CACGGTGCCGTCGAGCGGTTCGGCCGCGCCAGCCGCACTACCGTCCTCGACCATTCCGGCGTCACTTTCG
ACCGCGAATCGCCGTACGGCCGTCGTGACCTCTGGGCCGCTGGGGCGTGCGCCGGCCCAGCCGTCGGTAC
CCGCGGGTAAGTCGGGTATCGTTTCGGCACCGGACGCTGCCACGGCTGCGGCCACGGCCACGGCCAATGG
CGCGTCGGGTGTTGGTCACCTGCCAGCGGCCGTCCATACGCGCGGTCATGTGCGGCAGCTCTCGCATCAG
CTCGATGCGCCGGCGGGTGGTCGACAGATCGACGCGGCTACGGCCTACGCTGCGTTGAATACGAAGCAAG
CGCCGACCACTCCGCTCGATTCGCCGCTGCCAGGCCTTGGCATGGCACCAGGCAGCGAAAAGCCGGTGGA
TCCGGTCGTGATTCATTGCCGCCCGGGCGAAAACGCGATGATCCCGGTCGCGGAGAACTTCCCGAACCGC
TTCGATACGCCGTTCGTCGATCCGCACGTGATCGACACGAAGGGTGACGACTCGAATATGCGGGTCGCGA
ATTCGGTGTTCCTGACTGCGACGCGCACCACCCCGTTCGCGATCTGGATCGTCGACGGCAAGGCCGGCTC
GCAGATGTGCTCACTGACCCTCATCCCGCAGAATATCCCGGCGCAGAACCTTGTGCTCCAGATGGAAGGG
GCGATGCGCGGCGACCCTGCCAAGGCATTCGCACCGGGTGCGCAGAGCGAGGAAACCGGCCGCGAAGACC
AGTACACCATTGGCTTGCGGACCCTCATGCGTACCGTAGCGCGAGGGATTGCCCCGAGAGGTTTCAGCGA
GGAACGTCTGGACGTCGGCATGGCCGTGTCCAACGGCATCGCTGCGACCCCGGAGCACCTCTACGCGGGT
TCGCACTACGACATCTACATCTACCGACTGACCAACAAGTCCCGTGCTCCGGTGACGCTATCCGAAGAAG
CATTCGGCACGAAGGGCGTACGCGCGGTGGCGTTCAATCCATACATCATCTTGCCACCGGGGCAATCCAC
CGAGGTGTACATCATCGCGGACCGCCCGGATGCAGATGCGTCGGATTCTGAAGCCGAGGTAGGTCTCCAA
TGA
 Primer design