SecReT4
Protein ID: 330818870
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0630
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]83953..84807 [-]
Productsex pilus assembly protein TraE
Component typeTraE_F
UniProt IDF2LSG8
KEGG IDbgd:bgla_3p0630
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 7.9e-05, Aligned region: 8..183
Protein Sequence: 284 a.a.     [Download]
>gi|330818870|ref|YP_004351087.1| sex pilus assembly protein TraE [Burkholderia gladioli BSR3]
MKLPSFKLSWDTTASTARLAMIACACTSVATLGLTIKIMMDHERVILVPPNMTQQAQVGWESASQNYYKS
WGLFIATMIGSITPRTAAFTAQQLEPFFDAPLWPRVATQILSIADDPNYAHNGTLNVFTPRAVFWEPSTA
KVYITGLLDTTAYRNSALPVAELTATYEMRFMMRSGVPKVTYFNSYTGEPRTLKWLSNHKGDPALKPKPG
PQTTSILPQESDIAAQIQSQQAAEIAAEASAASASMAANASASGVAAAAAAPTASNAEKSTPIIGASAAS
GAHL
 
Nucleotide Sequence: 855 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c84807-83953 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGAAATTGCCATCGTTCAAACTGTCGTGGGACACCACGGCATCGACCGCTCGTCTCGCGATGATTGCCT
GCGCCTGCACGTCGGTTGCGACGTTGGGCCTGACCATCAAGATCATGATGGATCACGAGCGTGTGATTCT
CGTGCCGCCGAACATGACGCAGCAGGCGCAGGTCGGCTGGGAATCGGCGAGCCAGAACTACTACAAATCG
TGGGGGCTCTTCATTGCCACGATGATCGGTTCGATTACTCCGCGCACGGCCGCTTTCACGGCGCAGCAGC
TCGAACCGTTCTTCGACGCGCCGCTGTGGCCGCGTGTCGCCACGCAGATCCTCTCGATTGCGGATGACCC
GAACTACGCACACAACGGCACGCTGAACGTCTTCACTCCGCGCGCCGTGTTCTGGGAGCCGTCCACGGCC
AAGGTGTACATCACAGGCCTGCTCGACACGACCGCGTACCGCAATTCGGCTCTGCCGGTGGCGGAACTGA
CCGCTACCTACGAAATGCGTTTCATGATGCGCAGCGGAGTGCCGAAGGTGACGTACTTCAATTCGTATAC
GGGTGAACCGCGCACGCTTAAGTGGCTCTCGAACCATAAGGGCGACCCGGCACTGAAGCCGAAGCCGGGT
CCACAAACAACCTCGATCCTGCCGCAGGAATCTGACATCGCGGCACAGATCCAGAGCCAGCAGGCAGCCG
AAATTGCCGCAGAAGCATCGGCAGCGTCGGCCAGCATGGCTGCGAACGCATCGGCAAGCGGTGTTGCGGC
CGCTGCGGCCGCACCGACTGCATCCAACGCCGAAAAATCCACCCCAATCATTGGTGCCAGCGCGGCGTCG
GGAGCTCATCTGTGA
 Primer design