SecReT4
Protein ID: 330818871
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0640
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]84804..85082 [-]
Productsex pilus assembly protein TraL
Component typeTraL_F
UniProt IDF2LSG9
KEGG IDbgd:bgla_3p0640
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.5e-14, Aligned region: 3..84
Protein Sequence: 92 a.a.     [Download]
>gi|330818871|ref|YP_004351088.1| sex pilus assembly protein TraL [Burkholderia gladioli BSR3]
MREYQIPQYIDSFPQLMWFEVDEIMPFIACYGAGTLLHMTSPMIVTGAVLTWFYMRHKRKSLDGSLLHML
YWWGLMSLNKVFKNGLMREWIE
 
Nucleotide Sequence: 279 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c85082-84804 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGAGGGAATACCAGATTCCGCAGTACATCGACTCATTCCCGCAACTCATGTGGTTCGAGGTCGACGAAA
TCATGCCGTTCATCGCGTGTTACGGCGCGGGGACGCTGTTGCACATGACGTCGCCCATGATCGTCACGGG
TGCCGTTCTGACGTGGTTCTACATGCGGCACAAGCGTAAGTCGCTCGATGGCTCGCTGCTTCACATGCTG
TACTGGTGGGGGCTGATGTCTCTCAACAAAGTCTTCAAAAACGGCTTGATGCGGGAGTGGATCGAATGA
 Primer design