SecReT4
Protein ID: 330818876
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0690
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]89776..90321 [-]
Producttransglycosylase SLT domain-containing protein
Component typeOrf169_F
UniProt IDF2LSH4
KEGG IDbgd:bgla_3p0690
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 181 a.a.     [Download]
>gi|330818876|ref|YP_004351093.1| transglycosylase SLT domain-containing protein [Burkholderia gladioli BSR3]
MQSAFTVCLAACTWFACAPAFAVDLGPWAKCFIDAAKTYGQDPLLYFSIAQVESSGCKNLIHRNTDGTRD
IGCMQINSSAIPFLQKYGITEDRLLTDPCLNIHVGAWILQTKVRRLGPTWEAVGAYNAACSKLKGLDCFA
ARMKYIRKVAAAYNAHMDKAEPPGNEAEPPPVPPQLRMSGD
 
Nucleotide Sequence: 546 bp     [Download]
>gi|330818808|ref|NC_015378.1|:c90321-89776 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGCAATCTGCCTTCACCGTTTGTCTCGCGGCCTGCACATGGTTCGCGTGTGCGCCGGCATTTGCCGTCG
ACCTCGGGCCGTGGGCGAAATGCTTCATCGATGCGGCAAAAACCTACGGTCAGGACCCGCTTCTGTACTT
CTCAATCGCGCAGGTGGAGTCGAGCGGCTGCAAGAACCTGATCCATCGCAACACGGACGGCACGCGCGAT
ATCGGCTGCATGCAGATCAATTCCTCCGCAATTCCATTTCTGCAGAAGTACGGAATCACGGAAGATCGGC
TACTGACGGATCCATGCCTGAACATTCACGTCGGCGCATGGATCCTTCAAACGAAAGTGCGCCGATTAGG
GCCGACATGGGAAGCCGTCGGCGCGTATAACGCCGCCTGCTCGAAATTGAAGGGCCTCGACTGTTTCGCC
GCACGGATGAAATACATCCGCAAGGTAGCCGCGGCGTACAACGCGCACATGGATAAGGCCGAGCCGCCCG
GAAACGAAGCAGAGCCGCCACCGGTACCGCCGCAACTCAGAATGAGTGGCGATTAG
 Primer design