SecReT4
Protein ID: 330818877
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0700
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]90525..91589 [+]
Productsex pilus assembly protein TraF
Component typeTraF_F
UniProt IDF2LSH5
KEGG IDbgd:bgla_3p0700
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.2e-54, Aligned region: 68..293
Protein Sequence: 354 a.a.     [Download]
>gi|330818877|ref|YP_004351094.1| sex pilus assembly protein TraF [Burkholderia gladioli BSR3]
MLMDGRKISKRLAKQPLRLAEGMRAFAPVAVKAALAFSVIGLTGASAPANAQMASGNDLSYFQGKNDGWF
FYNDPKPQKKVQPPPPPPPQPVAATPAQPASAPPEPLSVAWLREKMPILRDNAINNPTPENVKAYLATQR
VMLDMAQDFANTANKVATTDPYLSENFRLPQATFASRETRFLIAKAKNQIIDNVAQHAGLWFFFDSKCTF
CQLQYETLTKVKKNTKFVVRYISTDGAPLPGMKSGDFVADQNQRVFRSLGLKLTPAVVLAWPPNKYLIVA
QGAMDEGGLYDKIVLAVTDQNLVPKSLTDAVNLEQRGILTPKDLATLRSTNADTDDPKVLVKMIENAIDG
RLQQ
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|330818808|ref|NC_015378.1|:90525-91589 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGCTTATGGACGGCAGAAAGATTTCAAAGCGGCTTGCGAAGCAACCCCTACGGCTAGCGGAGGGGATGC
GCGCATTCGCCCCGGTTGCCGTCAAGGCGGCATTGGCGTTTTCGGTCATCGGGTTGACCGGGGCATCTGC
GCCCGCCAACGCGCAGATGGCGTCGGGCAACGATCTCTCGTATTTCCAGGGGAAAAACGACGGCTGGTTC
TTCTATAACGATCCGAAGCCGCAGAAAAAGGTCCAACCGCCCCCACCTCCCCCGCCGCAGCCGGTTGCAG
CGACACCAGCTCAGCCAGCGTCTGCTCCGCCCGAACCGCTGTCGGTCGCCTGGTTGCGGGAAAAAATGCC
GATCCTGCGCGACAACGCGATCAACAACCCGACGCCGGAGAACGTGAAGGCGTATCTCGCAACGCAGCGC
GTCATGCTTGACATGGCGCAGGACTTCGCCAATACGGCGAACAAGGTAGCTACTACCGACCCTTATCTCA
GTGAAAACTTCCGTCTGCCGCAGGCGACGTTTGCCTCGCGCGAAACGCGCTTCCTTATTGCCAAAGCGAA
GAATCAGATCATCGACAACGTGGCGCAGCACGCGGGGTTGTGGTTCTTCTTCGATAGCAAGTGCACGTTC
TGCCAGTTGCAATACGAGACGCTCACGAAGGTCAAGAAGAACACAAAATTCGTGGTTCGCTACATCTCAA
CAGATGGCGCACCGCTGCCCGGTATGAAGTCAGGTGATTTCGTGGCGGACCAGAACCAGCGCGTGTTCCG
CTCGCTCGGCCTAAAGCTCACGCCGGCCGTCGTCTTGGCTTGGCCGCCAAACAAGTACCTCATCGTCGCA
CAAGGCGCGATGGATGAGGGCGGCCTCTACGACAAGATCGTGCTGGCCGTGACAGACCAGAATCTGGTCC
CGAAAAGCCTCACCGATGCTGTGAATCTTGAGCAGCGCGGGATCCTGACGCCCAAGGATCTGGCAACGCT
GCGCAGCACTAACGCCGATACCGACGATCCGAAGGTCCTCGTCAAGATGATCGAGAACGCGATCGACGGC
CGCCTGCAGCAGTAA
 Primer design