SecReT4
Protein ID: 330818878
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0710
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]91601..93202 [+]
Productsex pilus assembly protein TraH
Component typeTraH_F
UniProt IDF2LSH6
KEGG IDbgd:bgla_3p0710
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.8e-64, Aligned region: 51..453
Protein Sequence: 533 a.a.     [Download]
>gi|330818878|ref|YP_004351095.1| sex pilus assembly protein TraH [Burkholderia gladioli BSR3]
MPISILRRDRAQHAKPVARRMHWKPRLRKMAAYVGISVALFQAGVTPALASVSSDMDAMWNTTAARAYTT
NTSTGIYGGSFALRAPIAVAQIVSFDPPHFDAGCGGIDMFLGSFSFLSAQELSDLIRAIIQSAAGYLVHL
AIKAICDPCESIMSKLEKIMQELNAGQINTCHVAKTMVATALKGAGITDLLGKDDPATSEIDANALSVSG
TVSDWFSGITQIFNQGVNSVTQQAQSVAPSTATGNIVVNSVMTTSALDQFSALGIFGGEQGTTEMLISLF
GTSLLQTTQSADTTSGGVNTSLPAENFDSRLTFQDLIDGPSATPKPIYMCSDWQDDSPITCQTIDRSQNY
NALNFPGTQRYTVQTLAGDQSSSGLLGADPNADRQITVIQQGSILANMQAGIPLSQQQLAFLKAFPVGYQ
TLLLDAYESSPTMSLYNEIAQLMSEDLAVSLAEGLERVVTVAFIPGSQTNQAGGKTVAPIPPNVETAREQ
FERDMAKYEGETSNDRLQRLQSIVTALNIEARMTGSPILGGGK
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|330818808|ref|NC_015378.1|:91601-93202 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGCCTATCTCAATTCTTCGCCGAGACCGCGCGCAACACGCCAAACCGGTTGCTCGACGAATGCACTGGA
AGCCTCGCTTGCGCAAGATGGCGGCCTATGTCGGGATCAGCGTCGCACTCTTTCAGGCAGGCGTGACGCC
AGCACTCGCGAGCGTGTCGTCCGATATGGATGCAATGTGGAACACCACCGCCGCGCGAGCCTATACGACG
AATACGAGCACCGGGATCTATGGCGGGAGCTTCGCGCTGCGCGCGCCGATCGCTGTCGCCCAAATCGTGA
GCTTCGACCCACCCCACTTCGATGCGGGCTGCGGTGGGATCGACATGTTCCTCGGTTCGTTTTCGTTCTT
GTCAGCACAGGAGCTCTCCGACCTGATCCGCGCAATTATCCAGAGCGCGGCTGGCTACCTCGTACACCTG
GCGATCAAGGCGATCTGCGATCCCTGCGAGTCGATAATGTCGAAACTCGAAAAGATCATGCAGGAACTCA
ATGCCGGCCAGATCAATACGTGCCACGTGGCCAAGACTATGGTCGCCACCGCACTCAAAGGCGCGGGCAT
CACCGATTTGCTCGGCAAAGACGATCCAGCGACATCCGAAATTGACGCGAATGCCCTCTCCGTTTCGGGT
ACCGTCAGCGACTGGTTCTCGGGGATCACCCAGATCTTCAATCAGGGTGTCAATTCGGTTACGCAGCAAG
CGCAAAGCGTGGCCCCGAGCACGGCAACCGGCAACATCGTCGTGAACTCGGTCATGACGACGAGCGCGCT
CGATCAGTTCTCGGCGCTCGGCATCTTCGGGGGCGAGCAAGGCACGACTGAGATGCTCATCAGCCTGTTC
GGCACGTCTTTGCTTCAGACAACACAGTCGGCTGACACAACCTCAGGCGGCGTCAATACTTCGCTGCCAG
CTGAAAATTTCGATTCTCGCTTGACGTTCCAAGACCTGATCGACGGGCCGAGCGCCACACCCAAGCCGAT
CTATATGTGCTCAGACTGGCAAGACGATTCGCCGATCACGTGTCAGACCATCGATCGCAGCCAGAACTAC
AACGCGCTCAACTTCCCCGGCACGCAACGCTATACCGTGCAAACGCTCGCCGGTGATCAATCGTCGTCGG
GATTGCTGGGAGCGGACCCGAACGCGGACCGCCAGATCACGGTCATTCAGCAGGGTAGCATCCTCGCGAA
CATGCAGGCCGGCATTCCGCTAAGTCAACAGCAACTCGCCTTCCTCAAGGCCTTCCCTGTCGGTTATCAG
ACGTTGCTGCTGGATGCCTACGAATCCAGCCCGACGATGTCGCTCTACAACGAGATCGCGCAGCTGATGT
CCGAGGATCTTGCGGTGAGCCTGGCCGAAGGTCTCGAGCGCGTCGTCACCGTCGCCTTCATCCCGGGTTC
GCAGACGAATCAGGCCGGGGGTAAGACGGTGGCCCCGATCCCGCCGAACGTCGAAACTGCGCGCGAGCAG
TTCGAGCGGGACATGGCCAAGTATGAGGGCGAGACGTCGAACGATCGGCTCCAGCGCCTGCAATCTATCG
TCACGGCGCTGAACATCGAGGCTCGTATGACGGGTAGTCCGATTTTGGGAGGCGGCAAATGA
 Primer design