SecReT4
Protein ID: 330818879
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0720
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]93199..97281 [+]
Productsex pilus assembly protein TraG
Component typeTraG_F
UniProt IDF2LSH7
KEGG IDbgd:bgla_3p0720
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.2e-45, Aligned region: 53..546
Protein Sequence: 1360 a.a.     [Download]
>gi|330818879|ref|YP_004351096.1| sex pilus assembly protein TraG [Burkholderia gladioli BSR3]
MMQHAETRLATWRARARRVFIPATVGLFGMPLPALAGISNMQSYSNSYSFPTLYTAGDPVPIASALNSVA
MLFGGGDSVDSIVAGGMACMALVALIAVIGQSVLHNRFMIGEYLVMLLAAICLFIPTTSIQVVSYFSDSG
TAINSQPPQFVDNVPIGMAYAAGIAGLVDYTLTNKIETAFSSATADSNFMALGTDGFAKPLKLMLDMRDM
FDCNTHQTTCQNIQHFVHYCKYGGQNHSSTLDMTQLDNPATGAGIVGLLSSQTAGYTEYASQTVGTSITQ
AQIVPCTTAAQGLIATMNSYIGNAPVPELFSPNGVTLTQDLQVVTAQNDSSAETPNSTFNTSGSAFDDYS
AFIQGIASTNQIASNTFMINHIFSKPVLAAIQADAHPDAAATFTQIMGDAKERARVQMAGSGSMFTEFMT
STMNIMTFLFVALTPIVAILFLAAGMRAFSIVFTYLMFGIWTQSWMPCAAIISYYTQISYQNMIGGSRVQ
GMMFAPSNIDRLYDRTADMLASAGSMMAEAPLIMMAVMSGSMFALTSLANKANASGAQINPDVAAPNVSK
ATNSDAIISSYAANTGHAVAGAGIMGAVTSGGALTEAQVQASPQLTTSTGFQNSVGASASAQVAQTQTES
ALNQIAASAAAQFGRSAAHSMMAQVVKTTGLDQSLQTAMSNAIDHTTDSSARTSDSSGTATTEGVKASAQ
VGGSIPLIGGASVGASYGVDNKQSTDTTRASGTADANRSSESAQNSTTARTGTATSIGETGTSGTQASEN
HMVQEMTQRALSAQQALTNSRSLQHSMQESANGAAQSSIRMGALTQNIQSRDQGTQSEALAAVQAGARST
LQQATSDSGRSSQIMSQLMSGVDNNGGYSPTNITQLMRNATGLLRSNDFASQAVGYRVASEISRITGMGD
SQGMARTASAFAGGARTMEQQAGSMTPGLSNTEAGQVANLGSRIPAQLSTSAARLGVSDPSNPASFTPDV
TTTRYGQAVGQVNGEFGQANGVHSAAQAQGANNVAQGAAANRTAQGDILTGRQNMLSPSSTPTNDDRLAP
AAPVLPNTQAARAPENMSSTRPGATTSGVPVGSTGQGSGQGGTSLPENPSSTRPGATQMPSGRPPESSSA
TQLQTASPAVGLQNSPSSTPGQQNGRLPENPANTRPGATQSPNGQVPGNGGAESTRSAAQLQSVNPALGT
NNRPQLTTGQDTGQQSTSGQPARVLPENPSSSRPGATQIPSGQQPEHTRSEQVRGNAQGVGQRAGAESQT
GTGSPAHQPQFQNGGNPNSSSGTGPRMESASTVSNPTVTNNNAQSARPAAFGNTGSTVSPARGGATTSGV
PVGSTGQGSGQGGTSLPENPSSTRPGATRG
 
Nucleotide Sequence: 4083 bp     [Download]
>gi|330818808|ref|NC_015378.1|:93199-97281 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGATGCAACATGCTGAAACGCGTCTCGCGACATGGCGCGCACGTGCCCGTCGCGTTTTTATTCCCGCGA
CCGTGGGCCTCTTCGGCATGCCGCTGCCCGCGCTGGCCGGGATCAGCAACATGCAGTCGTACAGCAACTC
GTACAGCTTCCCTACGCTCTATACCGCCGGTGATCCGGTACCGATCGCCTCAGCCTTGAACTCGGTCGCG
ATGCTTTTCGGTGGAGGCGACTCGGTCGACTCCATCGTCGCCGGTGGCATGGCCTGTATGGCGCTCGTCG
CACTGATTGCGGTGATCGGCCAGTCGGTTCTGCACAACCGGTTCATGATCGGTGAGTATCTCGTGATGTT
GCTCGCAGCAATCTGCCTGTTCATCCCGACAACGTCGATCCAGGTCGTGAGCTATTTTTCGGACTCAGGC
ACAGCGATTAACTCACAACCGCCTCAGTTCGTGGATAACGTGCCAATCGGCATGGCCTATGCTGCGGGTA
TCGCGGGACTCGTCGACTACACCCTGACCAACAAGATCGAGACGGCGTTCTCGTCCGCGACGGCCGATAG
CAACTTCATGGCGCTCGGTACCGACGGCTTTGCCAAGCCGCTCAAGCTGATGCTCGACATGCGCGACATG
TTCGACTGCAACACGCACCAGACAACGTGCCAGAACATCCAGCATTTCGTCCATTACTGCAAGTACGGCG
GCCAGAACCACTCGTCGACACTCGACATGACGCAACTGGACAATCCGGCAACGGGAGCTGGTATCGTCGG
CCTGTTGAGCTCGCAGACAGCGGGCTATACGGAGTATGCATCGCAGACGGTCGGCACATCGATCACGCAG
GCGCAAATTGTGCCCTGCACGACCGCGGCACAAGGCCTGATTGCGACAATGAACTCCTACATCGGTAATG
CACCAGTGCCGGAGCTCTTCTCGCCGAACGGCGTCACCCTCACGCAAGATCTGCAGGTCGTGACAGCGCA
GAACGATTCGTCAGCCGAAACTCCGAACTCTACGTTCAACACCTCGGGTTCCGCGTTCGACGACTACTCG
GCATTCATCCAGGGTATTGCCTCGACCAATCAGATCGCCAGCAACACCTTCATGATCAACCACATTTTCT
CGAAGCCGGTGCTCGCAGCTATCCAGGCAGATGCGCACCCGGACGCCGCGGCAACGTTCACGCAGATCAT
GGGGGATGCAAAGGAACGTGCCCGCGTGCAAATGGCAGGCAGCGGTTCGATGTTCACCGAGTTCATGACG
AGCACGATGAACATCATGACGTTCCTGTTCGTCGCGCTCACGCCGATCGTAGCGATCCTTTTCCTGGCGG
CCGGCATGCGCGCGTTCAGCATCGTGTTCACGTACCTGATGTTCGGTATCTGGACGCAATCGTGGATGCC
TTGTGCCGCGATCATCTCCTACTACACGCAGATCTCGTATCAGAACATGATCGGCGGTTCGCGCGTGCAA
GGCATGATGTTCGCACCGAGTAACATCGACCGGCTGTACGACCGGACGGCAGACATGCTCGCGTCTGCTG
GCTCGATGATGGCCGAAGCACCGCTCATCATGATGGCGGTTATGTCAGGCTCGATGTTCGCGTTGACGAG
TCTCGCGAACAAGGCCAACGCGAGCGGTGCTCAGATCAACCCGGATGTCGCCGCCCCGAACGTCTCGAAG
GCAACAAACTCCGACGCAATCATTTCATCGTATGCGGCAAATACGGGACACGCAGTGGCCGGCGCAGGCA
TTATGGGCGCAGTCACAAGCGGCGGTGCCCTGACGGAAGCGCAGGTACAGGCTTCTCCGCAGCTCACCAC
GAGTACTGGTTTCCAGAACTCGGTGGGCGCGAGTGCATCGGCACAGGTTGCTCAAACGCAGACCGAATCG
GCGCTGAATCAAATTGCTGCGAGCGCCGCAGCTCAGTTTGGGCGAAGCGCAGCGCACTCGATGATGGCGC
AAGTCGTCAAGACGACTGGACTCGATCAATCGCTACAGACCGCCATGTCAAACGCGATCGATCACACGAC
AGATAGCTCGGCAAGAACCAGTGACTCCAGCGGCACTGCGACGACCGAAGGGGTTAAGGCAAGCGCACAG
GTTGGGGGATCGATTCCGCTGATTGGGGGAGCAAGTGTCGGCGCTAGCTATGGCGTAGACAACAAACAGT
CGACAGATACGACCAGAGCGTCTGGCACGGCTGACGCCAATCGTTCGTCGGAATCCGCACAAAACAGCAC
GACGGCCCGCACCGGCACGGCAACCTCCATTGGCGAAACTGGCACGAGCGGCACGCAGGCCAGCGAGAAC
CACATGGTTCAGGAAATGACGCAACGCGCCCTTTCTGCGCAGCAGGCATTGACCAACAGTCGATCGCTCC
AGCACTCGATGCAAGAGTCCGCGAACGGCGCAGCACAAAGTTCGATTCGCATGGGCGCACTCACCCAGAA
TATCCAGTCGCGCGACCAGGGTACGCAAAGCGAAGCCTTGGCGGCCGTGCAGGCCGGTGCGCGAAGCACG
TTGCAGCAGGCAACCTCGGATTCAGGTCGATCCAGTCAAATCATGTCCCAGCTGATGTCCGGCGTGGACA
ACAATGGTGGCTACAGCCCGACCAACATCACGCAGCTGATGCGCAATGCGACAGGTCTGCTTCGCTCGAA
TGACTTTGCGTCGCAGGCGGTGGGTTACCGCGTCGCATCGGAGATCTCGCGGATTACCGGGATGGGCGAC
AGCCAAGGGATGGCGCGTACCGCGAGCGCTTTCGCGGGGGGCGCTCGAACCATGGAACAACAGGCCGGCA
GCATGACACCGGGCCTTTCCAATACCGAGGCAGGACAGGTTGCAAACCTCGGGTCCAGGATTCCCGCGCA
GCTCAGCACCTCGGCTGCACGACTTGGCGTGTCGGATCCGAGCAATCCGGCTTCTTTCACGCCGGACGTT
ACGACGACCCGCTATGGTCAGGCTGTTGGGCAGGTTAATGGAGAATTTGGTCAGGCCAATGGCGTGCATA
GTGCCGCGCAAGCCCAAGGGGCAAACAATGTGGCTCAAGGGGCAGCAGCTAATCGCACGGCTCAAGGCGA
TATTTTGACGGGTCGTCAGAACATGCTCTCCCCGTCCAGCACTCCAACGAATGACGATCGCTTGGCTCCC
GCGGCTCCAGTTCTGCCGAATACCCAAGCGGCACGCGCGCCTGAAAATATGTCGTCCACTCGCCCAGGTG
CGACGACGAGCGGGGTACCGGTGGGAAGTACGGGGCAAGGTAGCGGCCAAGGGGGTACGTCGTTACCGGA
GAATCCGTCGAGCACGCGGCCCGGCGCGACCCAGATGCCGAGTGGTCGACCACCTGAATCGTCATCGGCC
ACCCAACTTCAGACGGCGAGTCCGGCCGTGGGTCTCCAGAATAGTCCGTCTTCGACGCCTGGTCAGCAAA
ACGGTCGCTTGCCGGAAAACCCGGCCAACACGCGGCCTGGCGCAACGCAGTCGCCGAATGGTCAAGTACC
GGGAAACGGGGGAGCTGAGTCGACACGCTCAGCTGCGCAGTTGCAGTCCGTGAATCCGGCGCTTGGCACG
AACAACCGCCCGCAGTTGACCACCGGCCAAGACACGGGACAGCAATCGACGTCTGGACAGCCGGCCCGAG
TATTGCCCGAGAATCCGTCGAGCTCACGGCCCGGCGCAACGCAGATACCGAGCGGACAGCAACCGGAGCA
CACTCGTTCCGAGCAGGTGCGCGGCAACGCTCAAGGCGTGGGTCAACGTGCGGGAGCGGAATCCCAAACG
GGTACTGGATCGCCGGCGCACCAGCCGCAATTCCAAAACGGCGGTAATCCCAACAGCAGCTCGGGAACCG
GGCCTCGGATGGAATCTGCCTCCACGGTGAGCAACCCGACGGTCACGAACAATAACGCGCAGTCGGCGCG
TCCCGCAGCTTTTGGCAATACCGGCTCAACGGTTAGCCCGGCACGTGGTGGTGCGACGACGAGCGGGGTA
CCGGTGGGAAGTACGGGGCAAGGTAGCGGCCAAGGGGGTACGTCGTTACCGGAGAATCCGTCGAGCACGC
GGCCCGGCGCGACCCGCGGATAA
 Primer design