SecReT4
Protein ID: 330818884
T4SS name [ID]Tra_F [597]
Gene symbol-
Locus tagbgla_3p0770
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_3p [GenBank: NC_015378] [Browse all T4SS(s) in this replicon]
Location [Strand]102809..104725 [+]
Productputative TraG family protein
Component typeTraD_F
UniProt IDF2LSI2
KEGG IDbgd:bgla_3p0770
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.8e-12, Aligned region: 157..501
TrwB_AAD_bind [PF10412], Evalue: 1.1e-11, Aligned region: 425..568
TraG-D_C [PF12696], Evalue: 1.2e-10, Aligned region: 422..555
Protein Sequence: 638 a.a.     [Download]
>gi|330818884|ref|YP_004351101.1| putative TraG family protein [Burkholderia gladioli BSR3]
MERRWWQVAQDRFFAGTLKRKKHAPQAHDIEPFKLRTLLEKFYEVRLGGAQDAWSLLSVGVSAVLGSRPL
GTMLPTFLPSFAVPACGWLLPALLAFSGSSYLAGRYLEPWQNHFFLKSSIGIPSDDPPAEYGDGLLFGYS
TDRGQPIVIPNSELFRHVSITGMSGVGKTVAGSFLMLQQIQRGGGVIFVDGKLDYDNILSMYRFACWAGR
GHEFDVINPGDPSLSNSYNPILDGDPDEKASRVLSLVPVNPAADYYRSEAFDALKTIFSALDRAGLVYTF
RDLVILLNNGSALEDLVVKLESKGRSEELDTLRLWLNRFRRALNPRDPLSGQIDINKLKQTLGGIAGKLS
MFASGGFGQVMNVYSPDVRLYESIKAGRITYVALPTMGKAETANPFAKMFVSDVKTACSWLQMKPEDRPK
IPFLCFFDEARSYLEENWGPLFEQARSAGLFLMPAMQTLPTTTQERETNERVTGNATTKLIFRVGSQNTA
EECAELIGYTKRVQKSLSSSSSKSKSADMLKPTPGHNMGDSAGESYGEREVEEYKVKPDDLKKLAKGECV
MLYEGDKVYDLRIPMVNLDKKFIRATASSIKDVRLNFRRLDSSLMKRAYRLNERVDELLAREVAAQRQNQ
NDDLNNAA
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|330818808|ref|NC_015378.1|:102809-104725 Burkholderia gladioli BSR3 plasmid bgla_3p, complete sequence
ATGGAACGGCGCTGGTGGCAAGTCGCTCAAGACCGGTTTTTTGCGGGGACGTTGAAACGCAAGAAGCACG
CCCCTCAGGCACATGACATTGAGCCGTTCAAACTACGTACGCTCCTCGAGAAATTCTACGAGGTTCGTCT
CGGGGGCGCGCAAGATGCATGGTCACTGCTGTCGGTCGGTGTCTCGGCCGTTCTGGGCAGTCGACCACTT
GGGACTATGCTCCCGACTTTTCTGCCGTCGTTCGCCGTCCCGGCCTGCGGCTGGCTGCTCCCTGCCCTTC
TGGCATTCAGTGGCAGCAGCTACCTCGCAGGCCGCTACCTCGAACCCTGGCAGAACCATTTTTTCCTGAA
GAGCTCGATCGGCATACCGTCCGATGACCCGCCTGCTGAATACGGTGACGGGTTGCTCTTCGGGTATTCG
ACGGATCGCGGCCAGCCGATCGTCATTCCGAACAGTGAACTGTTCCGTCACGTGTCTATCACCGGCATGT
CTGGCGTCGGTAAGACGGTCGCGGGTTCGTTCCTGATGTTGCAGCAGATCCAGCGCGGCGGGGGCGTGAT
TTTCGTTGACGGCAAGCTCGACTACGACAACATCCTGTCGATGTACCGTTTCGCATGCTGGGCGGGCCGC
GGACACGAATTCGACGTTATCAATCCGGGCGATCCGTCGCTCTCGAACAGCTACAACCCGATTCTCGACG
GCGACCCGGACGAGAAGGCCTCACGCGTCCTGTCGCTCGTGCCGGTCAACCCTGCGGCCGACTACTACCG
GTCGGAAGCCTTCGACGCGCTGAAGACCATCTTCTCGGCGCTCGATCGTGCGGGTCTTGTGTACACGTTC
CGAGATCTCGTGATCCTGCTGAACAACGGATCGGCCCTCGAAGACCTCGTGGTCAAGCTCGAATCGAAGG
GGCGCAGCGAAGAGCTCGACACACTGCGTTTGTGGTTGAATCGCTTCCGCCGCGCGTTGAACCCGCGCGA
TCCGCTGTCCGGCCAAATTGACATTAACAAACTGAAGCAAACGCTCGGCGGTATCGCTGGCAAGTTGTCC
ATGTTCGCATCGGGCGGCTTCGGTCAGGTGATGAACGTCTATTCGCCGGACGTGCGCCTTTACGAAAGCA
TCAAGGCGGGCCGAATTACGTACGTGGCACTGCCGACGATGGGCAAGGCAGAGACGGCGAACCCGTTCGC
GAAGATGTTCGTGTCCGACGTGAAGACGGCGTGTTCGTGGTTGCAAATGAAGCCAGAGGATCGACCGAAG
ATCCCGTTCCTCTGCTTCTTTGACGAAGCGCGCTCCTACCTTGAAGAAAACTGGGGTCCGCTTTTCGAGC
AGGCTCGATCAGCCGGCCTCTTCCTGATGCCGGCCATGCAGACGCTCCCGACCACGACGCAAGAGCGCGA
GACGAACGAACGCGTGACTGGTAACGCGACCACGAAGCTGATCTTCCGTGTCGGCTCGCAGAACACCGCT
GAGGAATGCGCGGAGCTGATCGGCTACACGAAGCGCGTCCAGAAGTCCCTGAGCTCGTCTTCTTCAAAGA
GCAAGAGTGCGGACATGCTCAAGCCAACGCCGGGCCACAACATGGGCGATTCCGCGGGAGAAAGCTATGG
CGAGCGTGAGGTCGAAGAATACAAGGTGAAGCCGGACGATCTGAAGAAGCTCGCGAAGGGCGAGTGCGTG
ATGCTGTACGAGGGCGACAAGGTCTACGACCTGCGCATCCCGATGGTCAACCTCGACAAGAAGTTCATCC
GGGCCACGGCGTCGAGCATCAAGGACGTGCGGCTCAACTTCCGTCGCCTCGACAGTTCACTGATGAAACG
CGCGTATCGCTTGAACGAGCGCGTCGACGAACTGCTCGCGCGTGAGGTCGCCGCGCAGCGACAGAATCAG
AACGATGATCTCAACAACGCGGCCTAA
 Primer design