SecReT4
Protein ID: 330822112
T4SS name [ID]Tra_F [549]
Gene symbol-
Locus tagbgla_2p0190
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_2p [GenBank: NC_015377] [Browse all T4SS(s) in this replicon]
Location [Strand]25262..26071 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDF2LS62
KEGG IDbgd:bgla_2p0190
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.1e-74, Aligned region: 44..258
Thioredoxin_2 [PF13098], Evalue: 1.4e-05, Aligned region: 163..251
Protein Sequence: 269 a.a.     [Download]
>gi|330822112|ref|YP_004350940.1| hypothetical protein bgla_2p0190 [Burkholderia gladioli BSR3]
MTRLHYVGLAIASTIAAMAIMSSNADAAGGDYPSAWQCDGQAKFNWYCDDEKPAAPAAASAPKPADTDDF
DKIKSADEMREMLKHRLDVATMDPTPANIKSYIKLWQFVQNKSAVFADVWRRDVWQDPSLDYSLKRPTNN
VAVHTYDQARDSDQDAQLRALAEKHGLIFFFRSDCPYCHAMAPTIQLLAQRYGIDVLPVSLDGRGIPGFP
SPTPDQGQAATWGVQQVPALFIASKETGDHAMIGSGTLSLQDIIDRIFVLTASKPGELF
 
Nucleotide Sequence: 810 bp     [Download]
>gi|330822093|ref|NC_015377.1|:c26071-25262 Burkholderia gladioli BSR3 plasmid bgla_2p, complete sequence
ATGACACGTCTGCACTATGTCGGCCTCGCGATTGCGAGCACGATCGCGGCTATGGCAATCATGTCGTCGA
ACGCGGACGCCGCTGGAGGCGATTATCCGTCCGCCTGGCAATGCGACGGCCAGGCGAAATTCAACTGGTA
TTGCGACGACGAGAAGCCTGCTGCGCCGGCAGCGGCGAGCGCGCCGAAGCCGGCGGATACAGACGACTTC
GACAAGATCAAGTCGGCCGACGAGATGCGTGAGATGTTGAAGCACCGGCTCGACGTCGCGACCATGGACC
CCACGCCGGCAAACATCAAGTCGTATATCAAGCTCTGGCAGTTCGTTCAGAACAAGAGTGCGGTGTTCGC
GGACGTCTGGCGTCGCGATGTTTGGCAGGACCCGAGCCTCGATTACTCCCTCAAGAGGCCGACCAATAAC
GTGGCGGTGCATACCTATGACCAGGCCCGAGACTCGGACCAGGATGCCCAGCTGCGCGCGCTTGCTGAGA
AGCATGGCTTGATTTTCTTCTTCCGCTCGGACTGCCCGTACTGCCATGCGATGGCGCCCACGATCCAGTT
GCTCGCCCAGCGCTATGGCATCGACGTGCTGCCGGTCTCGCTCGACGGCCGCGGCATCCCGGGATTTCCG
AGCCCCACGCCGGACCAGGGGCAGGCCGCGACCTGGGGCGTCCAGCAGGTGCCGGCGCTCTTCATCGCGT
CGAAGGAGACCGGCGACCACGCCATGATCGGCTCCGGAACACTGTCCCTCCAAGACATCATCGATCGCAT
CTTCGTCCTGACGGCCTCGAAGCCGGGGGAGCTCTTCTAA
 Primer design