SecReT4
Protein ID: 330824168
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1563
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1657600..1658886 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDF4GG85
KEGG IDadk:Alide2_1563
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.8e-58, Aligned region: 232..414
Protein Sequence: 428 a.a.     [Download]
>gi|330824168|ref|YP_004387471.1| conjugation TrbI family protein [Alicycliphilus denitrificans K601]
MSQDNTPDLATPQAGKVAPEAVALRAQPRPVTRLNRRTLAILVGGLSVAVLGATIWSLQPQRRGTGEQTE
LYNVDRVSKSEGLDALPTDYSKLPPALPPDVPELGPPLPGDLGPAIVASQQPVTPGYSPPGHDPEDALRK
EADAAAASSVFFRSGAQGQAATTVAQAAPGAPGVANTLAAFAPLAAGPASTAAQPADPTTVQNRQDQKEA
FLKAGSTETRNSGNLALPASPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGRHLLIPQGAR
ILGRYNSQVSYGQSRVQVVWNRIILPDTSSLTLDNLAGTDPAGYAGLEDGVDWHWDRIFAGAALTTLLGV
GAELASPGNRQNGDRVIIAGRDSLQDSVNQVGQEMTRRNLNIQPTLTERPGLPVRIIVNRDLVLRPYQPL
FFNRGSSR
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1658886-1657600 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAGCCAGGACAACACCCCCGACCTCGCCACGCCGCAGGCGGGCAAGGTCGCGCCCGAGGCGGTGGCGC
TGCGCGCCCAGCCGCGCCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCATCCTCGTCGGCGGCCTGTC
GGTCGCCGTGCTTGGGGCCACGATCTGGTCGCTGCAACCGCAGCGGCGCGGTACGGGCGAGCAAACCGAG
CTTTACAACGTCGATCGCGTCTCGAAGTCCGAAGGACTGGATGCGCTGCCGACGGATTACTCGAAGCTGC
CACCAGCCTTGCCGCCCGATGTGCCCGAGCTGGGGCCGCCGTTGCCCGGCGACCTTGGCCCGGCCATCGT
CGCTTCGCAGCAGCCGGTGACGCCGGGCTATTCGCCGCCAGGCCATGATCCCGAAGATGCCTTGCGCAAG
GAGGCGGACGCGGCGGCGGCCTCGTCGGTGTTCTTCCGCTCGGGCGCCCAGGGCCAGGCCGCCACCACGG
TCGCGCAAGCTGCGCCGGGTGCGCCTGGTGTTGCAAACACACTCGCGGCCTTCGCTCCTCTCGCTGCCGG
GCCTGCCTCGACGGCGGCCCAGCCCGCCGACCCGACGACCGTGCAGAACCGGCAAGACCAGAAAGAAGCG
TTCCTGAAAGCCGGTTCTACGGAAACCCGCAACTCCGGCAACCTGGCGCTGCCGGCGTCTCCGTATCAGG
TGATGGCCGGAACCGTGATCGCGGGCGCGCTGGTGACGGGCATCAAGTCGGACTTGCCGGGCGACGTGAT
CGCTACGGTGACGGAGCCTGTCTACGACACGGCTACGGGCCGGCATCTGCTGATTCCACAGGGGGCGCGC
ATCCTCGGGCGCTACAACAGCCAGGTCAGCTACGGCCAGAGCCGGGTGCAGGTGGTGTGGAACCGGATCA
TTCTGCCGGACACGTCCTCGTTGACGCTGGACAACCTGGCCGGCACCGACCCGGCCGGCTATGCCGGCCT
GGAGGATGGTGTCGATTGGCATTGGGATCGCATCTTCGCCGGCGCCGCCCTGACGACGCTGCTGGGCGTC
GGTGCCGAGTTGGCCTCGCCGGGGAACCGCCAGAACGGCGACCGCGTCATCATCGCCGGACGCGACAGCT
TGCAGGACAGCGTGAACCAGGTCGGACAGGAAATGACCCGGCGCAACCTCAACATCCAGCCGACGCTGAC
CGAACGGCCGGGTTTGCCGGTGCGGATCATCGTCAACCGCGACCTGGTTCTCCGCCCCTATCAGCCGCTG
TTCTTCAACCGGGGGAGTTCGAGATGA
 Primer design