SecReT4
Protein ID: 330824169
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1564
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1658889..1659872 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF4GG86
KEGG IDadk:Alide2_1564
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.8e-67, Aligned region: 100..319
Protein Sequence: 327 a.a.     [Download]
>gi|330824169|ref|YP_004387472.1| P-type conjugative transfer protein TrbG [Alicycliphilus denitrificans K601]
MNDLFRKSSLPAILLALAGCASQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMPAQLKPLEDAK
PAPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVVSLQPGEELVTVAAGD
TVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVITTSRRTYLLELASTEKTWMASVSWEYPRDRMLAL
QRQAQAANAAAPVDTGLALENLRFRYAISGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIGAQG
DGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGVARRN
 
Nucleotide Sequence: 984 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1659872-1658889 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCTCTTTGCCGGCGATCCTGCTCGCCCTCGCGGGCTGCGCCTCGCAGG
GCAAGCCACCGCCAACCATCTCGCTCGATGAGCCGGTGCAGGCGCAGCCGCTGCCGGAGCCGCCCGCGCC
GGTGGAAGTGGTGGCCGTGCCCGAGGTGCTGCCAATGCCGGCGCAGTTGAAGCCGCTCGAGGACGCCAAA
CCCGCGCCGGAGCCGGCCGACGAGAAGGTGCGCGTCTCGCGCGCCAATGCCGAGGCCCGCGTCGCGCCCA
CGCGCGAGGGCTACGTCAATGCGATTCAGGTCTGGCCCTTCACCGATGGCGCGCTGTATCAGGTCTATGC
GGCCGTCGGCCGTGTGACCGTGGTTTCGCTCCAGCCGGGCGAGGAACTGGTGACGGTGGCCGCCGGCGAT
ACCGTGCGCTGGATCGTGGGCGACACGTCCAGCGGTAGCGGTGCCGACCTGCGCGTGAACGTGCTGGTCA
AGCCGATCCGCTCGGGCCTCAAGACCAATCTCGTCATTACCACCAGCCGCAGGACGTACCTGCTGGAGCT
GGCTTCGACGGAGAAGACGTGGATGGCGTCCGTGTCCTGGGAGTATCCGCGCGACCGGATGCTGGCGCTA
CAGCGTCAGGCGCAGGCGGCCAATGCCGCCGCGCCTGTCGATACCGGGCTGGCGCTGGAGAACCTGCGCT
TCCGCTACGCGATCAGCGGCAGCAATCCGCCCTGGAAGCCGCTGCGTGCGTTCGATGACGGCGAAAAGGT
CTATATCCAGTTTCCGGCGGGCATCGCGCAAGGCGAGCTGCCGCCGCTGTTTGTCATCGGCGCGCAGGGC
GACGGGCAACTGGTGAACTACCGCTTCCGCTCGCCGTACTACATCGTGGATCGGCTGTTCGGCGCGGCCG
AACTGCGCCTGGGCGGTGACAAGGGCGACGTGGTGCGGATCGAGCGCACGGATGGCGTGGCACGGAGGAA
CTGA
 Primer design