SecReT4
Protein ID: 330824170
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1565
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1659869..1660573 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDF4GG87
KEGG IDadk:Alide2_1565
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.4e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|330824170|ref|YP_004387473.1| conjugal transfer protein TrbF [Alicycliphilus denitrificans K601]
MRFKKPQVRYADTPQPATPYQAAGQVWDERIGSPRVQAKNWRLMAFGCLTLALLMAGGLVWRSAQSIVTP
YVVEVDNAGQVRAVGEAATPYRPNDAQTAHHIARFVTLVRSLSIDSIVVRQNWLDAYDYTTDKGAAVLND
YARVNDPFARIGKESVTVQITSVVRASDTSFNVRWTERRYVNGAAAGLERWTAVVSIVLQPPRTEERLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1660573-1659869 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGCGATTCAAGAAACCGCAGGTGCGCTACGCCGACACGCCGCAGCCTGCCACGCCGTACCAAGCTGCCG
GCCAGGTGTGGGACGAGCGCATCGGCTCGCCGCGCGTCCAGGCGAAGAACTGGCGCCTGATGGCCTTCGG
TTGCCTGACGCTTGCGCTGCTGATGGCCGGCGGGCTGGTGTGGCGCTCGGCGCAATCCATCGTGACGCCC
TACGTCGTGGAGGTGGACAACGCGGGCCAGGTACGCGCCGTGGGCGAAGCCGCCACGCCATACCGGCCCA
ACGATGCGCAGACCGCGCACCACATCGCGCGCTTCGTGACGCTGGTGCGCTCGCTGTCCATCGACTCCAT
CGTCGTCCGCCAGAACTGGCTCGACGCCTACGACTACACGACCGACAAGGGCGCGGCCGTGCTCAACGAC
TACGCGCGGGTCAACGACCCGTTCGCGCGCATCGGCAAGGAGTCTGTGACGGTACAGATCACCAGCGTCG
TGCGCGCCAGCGACACCTCTTTCAACGTGCGCTGGACGGAACGCCGTTACGTCAACGGCGCCGCGGCTGG
GCTGGAGCGATGGACGGCCGTGGTGTCCATCGTGCTCCAGCCGCCGCGCACCGAAGAACGCCTGCGCAAG
AACCCCCTGGGCATCTACGTCAACGGCCTGTCGTGGAGCCGCGAACTGGATTCTTCCGAAGGAGCCAAGC
CATGA
 Primer design