SecReT4
Protein ID: 330824171
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1566
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1660586..1661971 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF4GG88
KEGG IDadk:Alide2_1566
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.7e-47, Aligned region: 37..264
Protein Sequence: 461 a.a.     [Download]
>gi|330824171|ref|YP_004387474.1| P-type conjugative transfer protein TrbL [Alicycliphilus denitrificans K601]
MNDVTIIDQFLNTFAAYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIINNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGLDAGGPIFLQLDDMMGFPEVF
LNLDAILVLFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVASGVK
VLVLAVIVGIGSGLFTQFQVHPDEPSLDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
IGAAGTAVAVGAAATGVGGAVTAGARMAPAAAKLAGAGARAATSAAGSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQSAGRAAASRASAAGQRMAAPFRAGWNGAAADGGAGAASGQGAAGEAASGAATAQTQEQPA
WAKRLHRRQQLTHAATTTAHALRGGDGGGSGQGPSLRDSDS
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1661971-1660586 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAATTCCTCAACACCTTTGCTGCCTACATCGACTCGGGTTTCGGGC
TGCTGCGGGGCGAAGTGGCGTTCCTCACGGCCACGCTGATCGTCATCGACATGACGATCGCCGGCCTGTA
TTGGGCCATGAGCCACGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTGTAC
GTCGGCGCCTTCGCCTACATCATCAACAACTTCAACTGGCTGGCGAGCATCGTCTTCCGCTCGTTCGCGG
GATTGGGCATCACCGCCACCGGCTCTGCCATCACGATGGAGAACTTCTTGCAGCCGGGCCGGCTGGCGAA
AACCGGCCTTGACGCGGGCGGGCCGATCTTCCTCCAGCTCGACGACATGATGGGATTTCCCGAGGTGTTC
TTGAACCTCGATGCCATCTTGGTGTTGTTCCTCGCCTGGCTGGTCGTGGTGCTCTGCTTCTTCGTGCTGG
CGATCCAGCTATTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTTTGGAACAAGACCTCGTTCCTGGCCGAAAAGGTCTTGGGCAACGTGGTGGCCTCCGGCGTCAAG
GTGCTGGTGCTGGCCGTGATCGTCGGTATCGGCTCGGGCCTGTTCACTCAGTTCCAAGTCCATCCCGATG
AGCCGTCGCTCGACCACGCACTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTGGGGATCTTCGG
CCCTGGCATCGCCACGGGCCTTGTGTCCGGTGCGCCGCAGCTCGGCGCGGGTGCGATGGCAGGCGCTGCC
ATCGGCGCAGCCGGGACGGCGGTGGCTGTTGGTGCTGCCGCGACGGGCGTAGGCGGTGCCGTGACCGCTG
GCGCGCGCATGGCACCGGCTGCCGCCAAGCTGGCCGGCGCTGGTGCGCGTGCGGCCACGTCGGCGGCTGG
CAGTGCGAAATCGGCGTTCCAGGCCGGCTCCGCCGCCGCTGGCGGCGGCGCAAAGGGCGCGATGGCGGGC
TTGGGCAACGTCGCCAAGACCGGCGCGCAGTCCGCCGGACGTGCGGCTGCATCCCGTGCATCCGCTGCCG
GGCAACGCATGGCCGCTCCCTTCCGCGCTGGCTGGAACGGCGCTGCCGCCGATGGCGGCGCGGGCGCGGC
ATCCGGTCAGGGTGCCGCAGGCGAGGCCGCATCCGGCGCCGCTACGGCGCAGACACAGGAACAGCCCGCT
TGGGCCAAGCGCCTGCATCGCCGCCAGCAACTCACCCACGCCGCGACCACCACCGCCCACGCGCTGCGCG
GTGGCGATGGCGGCGGCTCCGGCCAGGGGCCGAGCCTGCGCGATTCCGATTCATAA
 Primer design