SecReT4
Protein ID: 330824173
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1568
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1662301..1663026 [-]
ProductP-type conjugative transfer protein TrbJ
Component typeTrbJ
UniProt IDF4GG90
KEGG IDadk:Alide2_1568
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 6.5e-12, Aligned region: 2..37
Protein Sequence: 241 a.a.     [Download]
>gi|330824173|ref|YP_004387476.1| P-type conjugative transfer protein TrbJ [Alicycliphilus denitrificans K601]
MKKRLIAAAIAAMLCTATAHAQWVVVDPTNLVQNTLTAIRTLEQINNQIQQLQNEAQMLMNQARNLASLP
SSVVGQLRANLATTERLIAQARGLAYDVTNLDREFARLYPEQYAATVSGDQMYRDAQERWRNTLNGLQTT
MQMQAQVSQNLGEDESVLADLVGKSQSAEGALQAMQAMNQLLALQAKQSIQSQRLQITQDRAAALELARQ
AAATERAREVRRRFMGDGTPYTPQRVDFYGN
 
Nucleotide Sequence: 726 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1663026-1662301 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAAAAAGCGCCTTATCGCCGCAGCCATTGCGGCCATGCTTTGCACTGCCACCGCCCATGCGCAATGGG
TCGTGGTCGATCCCACGAACCTCGTGCAGAACACGCTGACCGCGATCCGCACGCTGGAGCAGATCAACAA
CCAGATCCAGCAGCTTCAGAACGAAGCGCAGATGCTGATGAACCAGGCGCGCAACCTCGCCAGCCTGCCG
TCCAGCGTGGTCGGCCAGTTGCGCGCGAATCTGGCAACGACCGAGCGGCTGATCGCCCAGGCCCGAGGCT
TGGCCTACGACGTGACGAATCTGGATCGGGAGTTCGCGCGCCTGTATCCCGAGCAGTACGCCGCCACCGT
CAGCGGCGACCAGATGTACCGCGACGCGCAGGAGCGTTGGCGGAACACGCTCAACGGCTTGCAGACCACG
ATGCAGATGCAGGCGCAGGTGTCGCAGAACCTGGGCGAAGACGAAAGCGTGCTGGCCGACCTCGTGGGCA
AGAGCCAGTCGGCCGAAGGGGCGCTCCAAGCCATGCAGGCCATGAACCAGTTGCTCGCCTTGCAGGCCAA
GCAGTCGATCCAGTCGCAGCGGCTCCAGATCACGCAGGATCGCGCTGCCGCGCTGGAGCTGGCGCGGCAG
GCGGCGGCCACCGAGCGCGCGCGCGAAGTACGGCGGCGGTTCATGGGCGATGGCACGCCGTACACGCCGC
AGCGCGTGGATTTCTACGGCAACTGA
 Primer design