SecReT4
Protein ID: 330824174
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1569
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1663023..1665476 [-]
Producttype IV transporter system protein VirB
Component typeTrbE
UniProt IDF4GG91
KEGG IDadk:Alide2_1569
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.1e-38, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 4e-17, Aligned region: 272..388
DUF853 [PF05872], Evalue: 3.3e-07, Aligned region: 613..684
Protein Sequence: 817 a.a.     [Download]
>gi|330824174|ref|YP_004387477.1| type IV transporter system protein VirB [Alicycliphilus denitrificans K601]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRMG
SGWALFIEAERRPAADYPHSEFPEPLSWVVEEERRAAFEESGNHFESGYHLTLLYLPPEESRARAAKMLY
ENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEIDWLDDAQTLTYLHATISTRRYRVGVPEVPFHIDAL
LTDSPLVGGLAPMLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKAEAERELARLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADAAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGQERNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGRSMRAAILGLG
GEHYDLGTDGEIAFQPLARIDSEGYRTWAAEWIEGRLLHEGVAVGPDEKAAIWSALGSLAGAPVEQRTMT
GLSVLLQSNTLRQALSPYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNRRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDIGR
VLLDAGVPGFAGAWLRHRGLDWAADLLPSFPGLAPGSLADQPLENLS
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1665476-1663023 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGCTGAACCTCGCCGAATACCGCCAGCGGCCGGCCTTGCTTGCCGACTGGCTGCCCTGGGCCGGGCTGG
TCGCGCCGGGCGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCCCGGTTTCGCGGGCCTGACCT
CGACAGCGCGACGCAAGGCGAGCTGATCGCCACGTCGGCACGGTTGAACAACGCGCTGCGCCGCATGGGA
TCGGGCTGGGCGCTGTTCATCGAAGCCGAGCGTCGGCCTGCGGCCGATTATCCGCACTCGGAGTTTCCCG
AGCCGCTTTCCTGGGTGGTGGAGGAAGAACGCCGGGCCGCCTTCGAGGAATCGGGCAATCACTTCGAGAG
CGGCTATCACCTGACGCTGCTTTACCTGCCGCCGGAAGAATCCCGCGCCCGTGCAGCCAAGATGCTCTAC
GAGAACACGCCGACGAATGGCGTGGACTGGCGCGAGCGGCTGCAAGCCTTCGTCGCGGAAACGGATCGCG
TCTTTGACCTGCTCGACGGCGTGATGCCGGAGATTGACTGGCTCGATGACGCGCAGACGCTGACCTACCT
GCACGCGACCATCTCGACGCGGCGCTATCGCGTCGGCGTGCCCGAAGTGCCGTTCCACATCGACGCGCTG
CTGACCGACTCGCCGCTGGTCGGTGGCCTGGCGCCCATGCTGGGCGACCAGCACCTGCGCGTGGTGTCGG
TGCGGGGCTTCCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGCTTTGCGTACCG
CTGGAGCACGCGCTTTCTCTGCCTCGACAAAGCCGAGGCGGAAAGAGAACTCGCCCGCCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCATCGCGCTGCTACGCGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAACAACAAGGCCGCCGACGCCGATGCTGCCTTGCAGGAGCTGGGCAGCGATCAAGT
CGCCTTCGGCTACCTGACGGCGACCGTCACCGTCATGGACGCGGACGCCGCCGTGGCCGACGAGAAGCTG
CGCATGGTGGAGCGCGTCATACAGGGTCGGGGCTTCGTCACCATCCCCGAAACGCTCAACGCCGTGGATG
CGTGGCTGTCCTCGCTCCCCGGCAATGCTTACGCCAACGTGCGCCAGCCCATCGTCTCGACGCTGAATCT
GGCGCACATGATGCCGGTGTCGGCGGTATGGGCCGGCCAGGAGCGCAACGATCATTTGGACGGCCCACCG
TTGATCGTGACACGTACCGATGGCGCTACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTCGCAGGCCCGACCGGCATGGGCAAGTCGGTCTTGCTCGCCACGCTGGCGATGCAGTTCCGCCG
CTATCGCGGCTCGCGCATCTTCGCCTTCGACATGGGCCGTTCCATGCGGGCCGCCATCCTCGGCCTGGGC
GGCGAGCACTACGACCTGGGCACGGATGGCGAAATCGCCTTCCAGCCGCTCGCGCGCATCGACAGTGAGG
GCTACCGCACCTGGGCCGCCGAATGGATCGAAGGCCGCTTGCTGCACGAAGGCGTGGCAGTCGGCCCCGA
CGAGAAGGCGGCTATCTGGTCGGCGCTGGGAAGTCTCGCCGGTGCGCCGGTGGAGCAGCGCACGATGACG
GGACTTTCCGTGCTGCTGCAATCGAACACGCTGCGGCAGGCGCTTTCGCCCTATGTGCTGGGTGGCGCCC
ACGGCAAGCTGCTGGACGCCGACCACGACCGGCTGGGCATGGCCGACGTGCAGTGCTTCGAGATGGAGGA
ACTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCATTACCTCTTTGCGCGTTTCGATGAACGCTTC
GACGGGGCGCCCACGCTGCTGATCCTCGATGAAGCGTGGCTGTTCCTCGATGACCCGGTGTTCGCGGCGC
GCATCCGGCAGTGGCTCAAGACGCTCAGGAAAAAGAACGTCAGCGTCATCTTCGCCACTCAGAGCCTTGC
CGACATCAAGGATTCGAGCATCGCGCCCGCGATCATCGAGAGCTGTGCGAGTCGGATTTTCTTGCCCAAC
CCGCAGGCGACAGAGCCGCAGATTCGCACGATCTACGAGGGCTTCGGCCTCAACAGGCGGCAGATCGAAA
TCGTCGCCACCGCGCAGCCCAAGCGTGACTACTACTACCAATCCCGCCTCGGCAACCGCCTGTTCGACCT
CGACCTGGGGCCGGCGGCCCTGGCCTTCGCGGGCGCGTCCACGCCGCAAGACCAGCGCGACATAGGCCGC
GTGCTGCTGGACGCCGGCGTGCCCGGCTTCGCGGGCGCTTGGCTGCGCCATCGCGGCCTCGATTGGGCGG
CCGACCTGCTGCCCTCGTTCCCCGGCCTCGCGCCGGGTTCCCTCGCTGACCAACCCCTGGAGAACCTGTC
ATGA
 Primer design