SecReT4
Protein ID: 330824175
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1570
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1665492..1665764 [-]
Productconjugal transfer protein
Component typeTrbD
UniProt IDF4GG92
KEGG IDadk:Alide2_1570
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.3e-11, Aligned region: 6..85
Protein Sequence: 90 a.a.     [Download]
>gi|330824175|ref|YP_004387478.1| conjugal transfer protein [Alicycliphilus denitrificans K601]
MSAPDTFADGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVFWIVGHSLAVWGARV
DPQFMAVFARHIRHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1665764-1665492 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAGTGCCCCCGACACCTTCGCGGACGGCTTCGAGGTACCGCTGCATCGCTCGCTGACCGAGCCGATTC
TGCTGGGCGGTGCGCCGCGAACCGTGGCGATCGCCAACGGCACGCTGGCCGCCGCTGTCGGCCTGGGCCT
GCAACTGTGGATTCCCGGCGTGGTGTTCTGGATCGTCGGCCATTCGCTGGCGGTGTGGGGTGCGCGCGTC
GATCCGCAGTTCATGGCCGTGTTCGCCCGGCACATCAGGCACCGCCCGCTGCTGGACGTGTGA
 Primer design