SecReT4
Protein ID: 330824176
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1571
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1665761..1666144 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDF4GG93
KEGG IDadk:Alide2_1571
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5e-24, Aligned region: 32..117
Protein Sequence: 127 a.a.     [Download]
>gi|330824176|ref|YP_004387479.1| conjugal transfer protein Trbc [Alicycliphilus denitrificans K601]
MTQMYVPAFRFSANPALRLARLRCLARPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQGPV
ARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1666144-1665761 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGACGCAGATGTACGTTCCTGCTTTCCGTTTTTCTGCAAATCCGGCTTTGCGTCTTGCGCGGCTGCGCT
GCCTGGCCCGCCCTGCGGGGCAAGGGCTGCTGCTGGCCGCGCTGCTGCTGTTCCTGGCCGGAACCGCGCA
GGCCGCCGGTTCCTCGATGCCGTGGGAAGGCCCCTTGCAGTCGATCTTGGAGTCGATTCAAGGGCCGGTG
GCGCGCATCGTCGCGGTCATCATCATCATCGCCACGGGCCTCGCGCTCGCCTTCGGCGACACGTCCGGCG
GATTCCGCAAGCTGATCCAGATCGTCTTCGGTCTGTCCATCGCCTTCGCGGCTTCGAGCTTCTTCCTGTC
GTTCTTCAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design