SecReT4
Protein ID: 330824177
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1572
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1666141..1667193 [-]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDF4GG94
KEGG IDadk:Alide2_1572
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-80, Aligned region: 27..293
FtsK_SpoIIIE [PF01580], Evalue: 1.4e-06, Aligned region: 145..211
TrwB_AAD_bind [PF10412], Evalue: 1.8e-06, Aligned region: 146..186
Protein Sequence: 350 a.a.     [Download]
>gi|330824177|ref|YP_004387480.1| P-type conjugative transfer ATPase TrbB [Alicycliphilus denitrificans K601]
MSAVPQSMSATSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDRTLWVDRLSSGRAPMGVELPEADGE
RIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVIDGMMTSAQ
AGFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCTARDHVPLRTRAGVVSM
TELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRAL
IAEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYQLADALETPFPELPPLPDAAPAAATSPSPHSLGELP
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1667193-1666141 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAGCGCCGTTCCGCAGTCCATGAGTGCCACGTCGCTCGACCGCCGCATCCAGATGCTGCGCACGGCGA
TGGGGCCGCTGATCGCCGCCGCGCTCGAAGACCCGGACGTGGTGGAGGTGATGCTGAATCCTGATCGCAC
CCTTTGGGTGGATCGGCTTTCCAGTGGACGCGCGCCGATGGGCGTGGAACTGCCCGAGGCGGACGGCGAG
CGAATCATCCGCCTGGTCGCGGCCCACGTTGGCGCAGAAGTCCATCGCGGCCAGCCGCTGCTGTCCGCCG
AGTTGCCCGAAACGGGCGAACGCTTCGAGGGCATCTTGCCGCCGGCAGCGCCGGGGCCGGCCTTCGCGCT
GCGCAAGCGCGCCATCGGCGTGATTCCGCTGGAGCGGTACGTCATCGACGGGATGATGACCAGCGCGCAA
GCGGGCTTTCTCGTTCGCGCCGTGCGCGAGCGGCAGAACGTGCTGATAGCCGGCGCCACCAGCAGCGGCA
AGACCACGCTCGCCAATGCTTTGCTCGCCGAAATCGCCGCCACCGGCGACCGCGTGCTGGTGCTCGAAGA
CACGGTGGAGCTGCAATGCACGGCCCGCGACCACGTTCCTCTGCGCACCCGCGCAGGCGTGGTGTCGATG
ACCGAGCTGGTGCGCTCGTCCATGCGCCTGCGGCCTGATCGCGTCGTCGTTGGCGAAGTGCGCGGCGCCG
AGGCACTGGATCTCATCAAAGTGTGGGGCACAGGCCATCCGGGCGGTATCGCCACGATCCATGCCGGCTC
CGCGCTCGGCGCGCTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTGAACCCGCCGCGTGCGCTG
ATCGCCGAGGCGGTCAACGTGGTGATCCACATCGCCGGGCGCGGGCGCAAGCGCCGCATCGAGAGCATCG
CCCGCGTCGTCGGCTTCGACGGCGTGGGCTACCAACTGGCGGACGCGCTGGAAACGCCGTTTCCCGAGCT
GCCGCCACTTCCCGATGCCGCACCCGCTGCGGCGACTTCCCCATCCCCTCACTCACTTGGAGAACTGCCA
TGA
 Primer design