SecReT4
Protein ID: 330824179
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1574
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1667651..1669651 [-]
ProductTRAG family protein
Component typeTraG
UniProt IDF4GG96
KEGG IDadk:Alide2_1574
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.7e-104, Aligned region: 111..558
TraG-D_C [PF12696], Evalue: 2.8e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 3.8e-31, Aligned region: 172..539
Protein Sequence: 666 a.a.     [Download]
>gi|330824179|ref|YP_004387482.1| TRAG family protein [Alicycliphilus denitrificans K601]
MQGTNVLFGQIAVVFGIVIAGVWGATQWTAAALGYQVRLGSPWFDFLGTSIYHPWKLFEWWFFFGAYAPE
VFDTGGAIAGASGMVAVVVAIAMSVWRSRQARLVTTYGSARWANAQDIRKAGLTQPAGVFLGQHDRQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTPHLGDGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIKRRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVGSRAPIKAKKLRYYADANFKRRVLPPPA
LADGQYADAPPLRPDDWSGLAIPAVPIAPAAASADGLGSADDGGPRRQPELSETVAYDPELAAPVADLGL
LDDDDDLPLPLPRQLDPAMQRTARLASLDPNDGIEL
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1669651-1667651 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGCAAGGGACGAACGTGCTGTTCGGTCAGATCGCCGTGGTATTCGGCATCGTGATCGCCGGAGTGTGGG
GCGCCACACAATGGACAGCCGCGGCCCTTGGCTATCAAGTACGCCTTGGCTCGCCCTGGTTCGACTTCCT
TGGCACTTCGATTTATCACCCGTGGAAGCTGTTTGAGTGGTGGTTCTTCTTCGGCGCCTATGCGCCGGAA
GTCTTCGACACCGGCGGCGCCATTGCCGGCGCCAGCGGCATGGTCGCCGTGGTCGTCGCCATCGCCATGT
CGGTCTGGCGCTCGCGCCAAGCGCGCCTGGTCACGACCTACGGCTCTGCGCGCTGGGCGAACGCTCAGGA
CATTCGCAAAGCCGGCCTCACACAGCCGGCCGGCGTGTTCCTCGGCCAGCACGACCGCCAGTACCTGCGG
CACGAAGGGCCGGAACACGTCCTGACCTTCGCGCCCACCCGCTCGGGCAAAGGCGTGGGCTTGGTGGTGC
CAACGCTGCTGTCTTGGCCGGCGTCGGCCGTCATCCACGACATCAAGGGCGAGAACTGGCAGATCACCGC
CGGCTGGCGCTCGCGCTTCTCGCATTGCCTGCTGTTCAACCCGACCGATGCGAAGTCGGCCGCCTACAAC
CCGCTGCTGGAGGTGCGACGCGGCGCGCATGAAGTGCGCGACGTTCAGAACATTGCCGACATTTTGGTTG
ATCCCGAAGGCGCGCTGGAGAAGCGCAACCATTGGGAGAAGACCTCGCACGCGCTGCTGGTCGGGGCCAT
CCTGCATGTGCTCTACGCGGGCGAGGACAAGACGCTGCGCGGCGTCGCCAACTTTCTGTCCGATCCGGCC
AGCCCGTTCGAGCTGACCTTGCACCGGATGATGACCACGCCGCACCTCGGCGATGGGCCGCATCCGGTCG
TCGCATCGGCGGCGCGTGAAGTTCTCAACAAGAGCGACAACGAACGCTCGGGCGTGCTGTCCACGGCCAT
GTCGTTCCTCGGCCTGTACCGCGACCCGACCGTGGCCGAAGTCACCTCGCGCTGCGACTGGCGCATCGCT
GACCTGATCGCGGCCGAGCATCCGGTATCGCTGTATCTGGTAGTGCCGCCTTCGGACATATCGCGGACGA
AGCCGCTCATTCGCCTGATCCTCAACCAGATCGGGCGGCGCCTCACCGAATCGCTCGATGGCTCCGATGG
CATCAAGCGCCGCCACAAGCTGCTGCTGATGCTCGATGAGTTCCCTGCGCTGGGGCGCCTGGACTTCTTC
GAGACGGCGCTGGCCTTCATGGCGGGCTACGGCATCCGCAGCTTCCTCATCGCGCAGTCGCTCAACCAGA
TCGACAAGGCGTATGGGCAAAACCACTCCATCCTCGACAACTGCCATGTGCGCGTGACGTTCGCCACGAA
CGACGAGCGCACCGCCAAACGGATCTCCGAGACGCTGGGCACGGCCACCGAGCTGCGCGCCCAGCGCAAC
TACGCGGGCCATCGGCTCGCGCCGTGGCTGGGCCACCTTATGGTGTCGCGTCAGGAAACCGCGCGCCCGC
TGCTGACGCCGGGCGAAGTCATGCAGCTTCCGCCTGACGAGGCTGTGGTGATGGTGGGAAGCCGGGCGCC
GATCAAGGCGAAGAAGCTGCGCTACTACGCGGACGCCAATTTCAAGCGTCGTGTGCTGCCACCGCCCGCG
CTGGCGGATGGGCAGTACGCCGACGCGCCGCCATTGCGGCCCGACGACTGGAGCGGGTTGGCGATTCCCG
CCGTGCCCATCGCACCGGCCGCGGCATCCGCTGATGGCCTGGGTTCCGCCGATGACGGTGGCCCACGCCG
TCAGCCCGAACTCTCCGAAACCGTCGCCTACGACCCCGAGCTGGCCGCCCCCGTGGCCGACCTTGGGCTG
CTCGATGACGACGACGACCTGCCGCTTCCCCTTCCGCGCCAGCTCGATCCAGCCATGCAGCGCACGGCCC
GGCTGGCTTCCCTCGACCCCAACGACGGAATCGAGCTATGA
 Primer design