SecReT4
Protein ID: 330824192
T4SS name [ID]Trb [313]
Gene symbol-
Locus tagAlide2_1587
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1684414..1685001 [-]
Productpeptidase S26
Component typeTraF
UniProt IDF4GGA9
KEGG IDadk:Alide2_1587
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.4e-54, Aligned region: 46..190
Protein Sequence: 195 a.a.     [Download]
>gi|330824192|ref|YP_004387495.1| peptidase S26 [Alicycliphilus denitrificans K601]
MTAVSNSGTAPRSRSRLRARLVLASLSACGLAALAWASFVQPLPRLIYNPSVSVAVGWYRVETLGRGTSS
PPRPLSVGSIVLTTLPPDAAALAAQRGYLPSRVPLLKRVGAVAPQEVCITGRIVRIDGVPSAAVLPADRW
GRPLPSWQQCRRIEPGELFLLSVTNPASFDSRYFGPVSASAVIGVAHPVWLESRP
 
Nucleotide Sequence: 588 bp     [Download]
>gi|330822653|ref|NC_015422.1|:c1685001-1684414 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGACCGCCGTTTCCAATTCCGGCACCGCACCGCGTTCTCGATCGCGCCTGCGCGCTCGTTTGGTGCTGG
CGAGCCTGTCCGCCTGCGGCCTCGCTGCGCTGGCCTGGGCGTCCTTCGTGCAGCCGCTGCCGCGCCTGAT
CTACAACCCGTCCGTCAGCGTGGCGGTCGGCTGGTATCGTGTCGAAACGCTGGGCCGCGGCACCAGCTCG
CCGCCACGCCCGTTGTCCGTGGGCAGCATCGTCCTGACCACGCTGCCGCCAGATGCCGCCGCGCTGGCTG
CGCAGCGCGGCTACCTGCCGTCGCGCGTGCCGCTGCTCAAGCGCGTGGGCGCCGTCGCGCCGCAGGAGGT
GTGCATCACTGGCCGCATCGTCCGCATCGACGGCGTGCCTTCGGCCGCCGTGCTGCCCGCTGACCGCTGG
GGCCGCCCGCTGCCATCCTGGCAGCAATGCCGTCGCATCGAACCCGGCGAACTGTTCCTGCTCAGTGTGA
CCAACCCGGCGTCGTTCGACAGCAGGTACTTTGGGCCGGTCAGCGCATCCGCCGTGATCGGCGTCGCGCA
TCCGGTCTGGCTGGAGTCCCGCCCATGA
 Primer design