SecReT4
Protein ID: 330824380
T4SS name [ID]Tfc [738]
Gene symbol-
Locus tagAlide2_1781
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1876102..1876722 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDF4G5J1
KEGG IDadk:Alide2_1781
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|330824380|ref|YP_004387683.1| lytic transglycosylase catalytic subunit [Alicycliphilus denitrificans K601]
MAAAIGTPGRERRPSRVAIRCTGAVLLLATGGWALAALAREVPPPAYRLAAHRADVPAAVLYAVALQESG
AMLRGRLIPWPWTLNVAGTPQRYATRAEACAGLRRALARTPANRIDAGLGQVNLGYHTHRYTQPCELLDP
YRNLAIAAEILHEQHTPGEDWLLAIGRYHRPAGGAPAARYRRSVHRHLTRVLDPGVPVPTLQATTP
 
Nucleotide Sequence: 621 bp     [Download]
>gi|330822653|ref|NC_015422.1|:1876102-1876722 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGGCAGCGGCAATAGGTACTCCGGGCCGGGAGCGTCGGCCGTCCCGCGTCGCCATCCGCTGTACCGGCG
CCGTGCTGCTGCTCGCCACCGGCGGCTGGGCCTTGGCCGCCCTGGCGCGGGAAGTGCCGCCGCCGGCCTA
TCGACTGGCGGCGCATCGTGCAGACGTGCCGGCGGCGGTGCTGTACGCGGTGGCCTTGCAGGAGAGCGGC
GCCATGCTGCGCGGGCGCCTGATCCCCTGGCCGTGGACGCTCAATGTCGCCGGCACGCCGCAGCGCTACG
CCACCCGCGCCGAGGCCTGCGCGGGGCTGCGCCGGGCGCTCGCCCGCACGCCGGCCAATCGCATCGACGC
CGGCCTCGGCCAAGTCAATCTCGGCTACCACACGCATCGCTACACGCAGCCCTGCGAGTTGCTGGACCCG
TACCGCAACCTCGCCATCGCTGCGGAAATCCTGCACGAACAGCACACGCCGGGAGAGGACTGGCTGCTTG
CCATCGGCCGCTACCACCGGCCCGCCGGCGGGGCACCCGCGGCGCGCTACCGGCGCAGTGTGCATCGGCA
CCTGACCCGCGTGCTCGACCCCGGCGTTCCCGTTCCAACCCTCCAGGCCACCACGCCATGA
 Primer design