SecReT4
Protein ID: 330824383
T4SS name [ID]Tfc [738]
Gene symbol-
Locus tagAlide2_1784
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1879414..1880163 [+]
Productintegrating conjugative element membrane protein
Component typeTfc8
UniProt IDF4G5J4
KEGG IDadk:Alide2_1784
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3e-72, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|330824383|ref|YP_004387686.1| integrating conjugative element membrane protein [Alicycliphilus denitrificans K601]
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHAQGMLHYELDQ
LSTHFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASAQASAGSHRPTKDFRYYIGLVYVNVES
YLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVRRDIRRFGAGRESGFIYHRARASLIPLAVLP
WVTYLALPVSVNPLLILLPSAALLGVAVCIAAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|330822653|ref|NC_015422.1|:1879414-1880163 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAGCGATCCGGCCGTCGCGGCCCAACGCCAGCAGCAACGACAGCAAGGCCTGATCGCCGGCCTGGTCA
CGCTGCCGTTCCGCTTCTTCGGCGTGCTGTGCGGCGCGCTGCTGCTGTGCATCCTGATCGAATGCGTCGG
CATGCACTTCTTCTGGCCCGAGCAGGGCTGGCGCCACGCGCAGGGCATGCTGCACTACGAGCTGGATCAG
CTTTCCACGCATTTCACCCGCAGCGCGCTGGTGCAGGAGCCGGGGCGCACCGCGCACCGGCTGGTCGAGC
AGGGCTACGACTGGCTGTTCGTGAAAAGCGGTCTGCTGGACTGGATACGCGACGCCTCGGCGCAGGCCAG
CGCCGGCAGCCATCGTCCGACCAAGGATTTCCGCTACTACATCGGCTTGGTCTATGTGAACGTGGAGAGC
TACCTGATCGCGGCGGCCTATACGACGCTGGTCTTCCTCGTGCGGCTGCTGGTGCTGTGCCTGACCCTGC
CGCTGTTCCTGATGGCCGCCTTCGTCGGGCTGGTGGACGGCCTGGTGCGCCGGGACATCCGCCGCTTCGG
CGCGGGACGCGAGTCGGGGTTCATCTATCACCGCGCCAGGGCCAGCCTGATCCCGCTGGCCGTGCTGCCG
TGGGTGACTTACCTGGCATTGCCGGTCAGCGTGAACCCGCTGCTGATCCTGTTGCCCAGTGCCGCATTGC
TCGGCGTGGCGGTGTGCATTGCGGCGGCGACGTTCAAGAAGTATCTGTAG
 Primer design