SecReT4
Protein ID: 330824392
T4SS name [ID]Tfc [738]
Gene symbol-
Locus tagAlide2_1793
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1895984..1896349 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDF4G5K3
KEGG IDadk:Alide2_1793
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.5e-31, Aligned region: 30..108
Protein Sequence: 121 a.a.     [Download]
>gi|330824392|ref|YP_004387695.1| hypothetical protein Alide2_1793 [Alicycliphilus denitrificans K601]
MGQTNRRTSARPALAVVLAVSFSALQPAAAADSLASEREQLAALTRQLDLIDRLAEHAANTAPQERTRYH
FDYARLRADLNRVRAGLQDYLVPQRAQPRDPVPLAGDYVRRDRADDEEPSP
 
Nucleotide Sequence: 366 bp     [Download]
>gi|330822653|ref|NC_015422.1|:1895984-1896349 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGGGACAGACCAACCGCCGCACATCCGCGCGGCCTGCGCTTGCCGTGGTGTTGGCTGTGTCGTTCTCGG
CGCTGCAGCCTGCCGCTGCTGCCGACAGCCTCGCCTCGGAGCGTGAGCAGCTCGCCGCGCTCACCCGCCA
ACTCGACCTGATCGACCGCCTCGCCGAGCACGCCGCCAATACCGCTCCGCAGGAACGCACCCGCTACCAC
TTCGACTACGCCCGACTGCGTGCCGACCTGAACCGCGTTCGCGCCGGCCTGCAGGACTACCTCGTGCCCC
AACGCGCCCAGCCGCGCGATCCCGTCCCGCTGGCCGGCGACTACGTCCGCCGCGACCGCGCCGACGACGA
GGAGCCGTCGCCATGA
 Primer design