SecReT4
Protein ID: 330824395
T4SS name [ID]Tfc [738]
Gene symbol-
Locus tagAlide2_1796
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1896989..1897399 [+]
Productconjugative transfer region protein
Component typeTfc11
UniProt IDF4G5K6
KEGG IDadk:Alide2_1796
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.1e-49, Aligned region: 12..132
Protein Sequence: 136 a.a.     [Download]
>gi|330824395|ref|YP_004387698.1| conjugative transfer region protein [Alicycliphilus denitrificans K601]
MAVPSETPQDTLVSFLPHRLNRQPVVVRGLTADELWICAGLSAAAGFALGLPLAWLTHSIAMVPTLIVAG
IALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRHPALAALLGGQRLITRSGYWTTRRNADRVAP
 
Nucleotide Sequence: 411 bp     [Download]
>gi|330822653|ref|NC_015422.1|:1896989-1897399 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGGCCGTCCCCTCGGAGACCCCGCAAGACACGCTGGTGAGCTTCCTGCCGCACCGGCTGAATCGCCAGC
CGGTGGTCGTGCGCGGGCTGACCGCCGACGAGTTGTGGATCTGCGCCGGCCTGTCGGCCGCAGCCGGATT
CGCACTCGGCCTGCCGCTGGCCTGGCTCACGCACAGCATCGCCATGGTGCCGACGCTGATCGTCGCCGGC
ATCGCGCTGGGCGTCTTCGTCGGCGGTGGTTTTCTGCGCGCACAGAAGCGCGGCCGGCCCGACACCTGGC
TCTACCGACAGCTCCAGTGGCGGCTGGCCCTGCGGCACCCGGCGCTGGCAGCGCTCCTGGGCGGGCAGCG
CCTCATCACCCGCTCGGGCTACTGGACGACCCGGCGCAACGCCGATCGAGTTGCGCCATGA
 Primer design