SecReT4
Protein ID: 330824408
T4SS name [ID]Tfc [738]
Gene symbol-
Locus tagAlide2_1809
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]1911038..1912444 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDF4G5L9
KEGG IDadk:Alide2_1809
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|330824408|ref|YP_004387711.1| integrating conjugative element protein [Alicycliphilus denitrificans K601]
MNASLPDFLHRAKSPLRATLLVAAITLVVGVAWAQTRIDPNGVNVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATAAVASLPALIIQRADPGLYNL
LTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLAEGMALRDAVSSTDAVSAIEQAESNKGNNGV
PWVGGGNAGGSGQSSIKVVGDVTRAGYNLLNGRSATDTSSIARSACGNRLTCQTWSSPGAAAAFANRVLG
EREQRTCENCTKTQTTPGVGLTPVIQEEYETKLQVLQELVTGARPTTLANLDAAGSSSLPITRGVIEALR
DEPDQDVLGRRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREVQKPRSGTP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|330822653|ref|NC_015422.1|:1911038-1912444 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAACGCCTCCCTCCCTGACTTCCTGCACCGCGCGAAGTCGCCCCTGCGGGCCACGCTGCTCGTGGCGG
CCATCACGCTGGTCGTCGGCGTCGCCTGGGCGCAGACCCGCATCGACCCCAATGGCGTGAACGTCAGTGG
CAGCGTGATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGGGCCGTGTCGATGGGTGGTGCCGGC
AACATGCAGAGCATCGGCGTCGGCGTCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCACCA
CGACGCTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGACGATCATGAGCAACGTGATCCAGAA
CGCCACTGCCGCGGTGGCGTCACTCCCGGCGCTCATCATCCAGCGCGCCGACCCGGGCCTGTACAACCTG
CTCACCAACGGCATCCTCCAGGCGCGCCTGGATTTCGACCGCTCGAAGATGACCTGCCGGGCCATCGCCA
ATCGCATGGCGGACATGGCCGGCGGCCAGGCCGGCTGGGACCAGCTCGCCGAAGGGATGGCGCTGCGGGA
TGCGGTCAGCAGCACCGATGCCGTCTCCGCCATCGAGCAGGCCGAGTCCAACAAGGGGAACAACGGCGTG
CCCTGGGTCGGCGGCGGCAACGCGGGCGGCTCCGGCCAGAGTTCGATCAAGGTGGTCGGCGACGTGACGC
GCGCGGGCTACAACCTGCTCAACGGGCGCAGCGCCACCGATACCTCGTCGATCGCGCGCAGCGCCTGCGG
CAACCGCCTGACCTGCCAGACCTGGTCGTCGCCTGGCGCGGCCGCGGCCTTTGCGAACCGCGTGCTGGGC
GAACGCGAGCAACGCACCTGCGAAAACTGCACGAAGACCCAGACCACGCCTGGCGTCGGGCTCACGCCAG
TGATCCAGGAAGAGTACGAGACCAAGCTGCAGGTGTTGCAGGAACTGGTGACGGGCGCCCGGCCGACGAC
ACTGGCCAATCTCGACGCGGCCGGCAGCAGCTCGCTGCCGATCACCCGCGGCGTGATCGAGGCCCTGCGT
GACGAGCCCGACCAGGACGTGCTGGGCCGGCGTCTCGCGTCCGAGGCTGCGCTGTCCAGCGTGCTGGAGA
AGGCCCTGCTGCTGCAACGCACGTTGCTGACCGGCAAGAAGGAGCCGAACGTCGCCGCCAACGAGCTCGC
CGTGCAGGCGGTGGACCAGGAGAACAGCGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAGCTGGAG
CTGCGCCGCACGCTGGCCGGCAACTCGGCGATGGCGATCATCCAGCGCCACAGTACCCGCGCTGCCGGCT
CGCGCGGCGTCTTCGAGGGCGACACCACGCGCGACCGTCTGCGGGAAGTCCAGAAGCCGCGGAGCGGTAC
GCCATGA
 Primer design