SecReT4
Protein ID: 330824500
T4SS name [ID]Tfc [739]
Gene symbol-
Locus tagAlide2_1909
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]2011415..2012014 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDF4G6H8
KEGG IDadk:Alide2_1909
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|330824500|ref|YP_004387803.1| lytic transglycosylase catalytic subunit [Alicycliphilus denitrificans K601]
MAAAITATSLARRADRAALVLVLCACTAIAFGQEVPPPAYQLAAQQAGVPSPVLYAVALQESGARLRGRL
IPWPWTLNVAGRAERYATRAEACAGIRRALARTPANRIDAGLGQVNLGYHAHRYAHPCELLDPYRNLAIA
AEILQEQHTPGDNWLVAIGRYHRPAGGAPAARYRRSVHQHLTRVLGPGAALPTARSPMP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|330822653|ref|NC_015422.1|:2011415-2012014 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGGCAGCGGCAATAACGGCAACGAGCTTGGCTCGCCGCGCCGACCGCGCGGCATTGGTCCTGGTGCTCT
GCGCCTGCACGGCCATCGCCTTCGGCCAGGAAGTGCCGCCACCCGCCTACCAGCTCGCGGCCCAGCAGGC
GGGCGTGCCGTCGCCGGTGCTGTACGCGGTGGCGCTGCAGGAGAGCGGCGCCCGGCTGCGCGGCCGGCTG
ATCCCGTGGCCGTGGACGCTCAACGTCGCCGGCCGCGCCGAACGCTACGCCACACGGGCCGAGGCCTGCG
CCGGCATCCGCCGGGCGCTCGCCCGCACGCCGGCCAACCGCATCGACGCCGGCCTCGGCCAGGTCAACCT
CGGCTACCACGCGCACCGCTACGCGCATCCCTGCGAGCTGCTCGACCCGTACCGCAACCTCGCCATCGCC
GCGGAAATCCTGCAGGAGCAGCACACGCCGGGCGACAACTGGCTGGTCGCCATCGGCCGCTACCACCGCC
CCGCAGGCGGGGCGCCGGCCGCCCGCTATCGCCGCAGCGTCCATCAGCACCTGACCCGCGTGCTCGGGCC
GGGCGCTGCACTTCCCACTGCCCGGAGCCCCATGCCATGA
 Primer design