SecReT4
Protein ID: 330824503
T4SS name [ID]Tfc [739]
Gene symbol-
Locus tagAlide2_1912
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]2014754..2015503 [+]
Productintegrating conjugative element membrane protein
Component typeTfc8
UniProt IDF4G6I1
KEGG IDadk:Alide2_1912
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.8e-68, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|330824503|ref|YP_004387806.1| integrating conjugative element membrane protein [Alicycliphilus denitrificans K601]
MSDPAVAVQRQQVRQQGLIAGLVTLPFRLFGVLIGSLLLCIVIECIGMHFLWPEQGWRHAQGMLNYELSQ
VSEHFTQSVLVQEPGRSARQLVEWAYQGLFVKTGLLDWIRDAAAQSRAGARSQAQDFRYYIGQLYVHVES
YLIASAYTVLVFLVRLLVLVLTLPLFLMAAFTGLVDGLVRRDVRGFGAGRESGFVYHRARASLMPLAVLP
WVTYLALPVSVHPLLILLPSAALLGVAVCIASATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|330822653|ref|NC_015422.1|:2014754-2015503 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAGCGACCCCGCCGTCGCCGTCCAGCGCCAACAGGTTCGCCAGCAGGGCCTGATCGCGGGGCTGGTGA
CGCTGCCGTTCCGGCTGTTCGGTGTGTTGATCGGTTCGCTCCTGCTGTGCATCGTGATCGAGTGCATTGG
CATGCACTTCCTCTGGCCCGAGCAGGGCTGGCGCCATGCCCAGGGCATGCTGAACTATGAGCTGTCGCAG
GTCTCGGAGCACTTCACGCAAAGCGTGCTGGTACAGGAACCGGGGCGCAGCGCGCGCCAGCTCGTAGAGT
GGGCCTACCAAGGGCTGTTTGTGAAGACGGGCCTGCTGGACTGGATACGCGACGCCGCGGCGCAATCGCG
TGCCGGCGCGCGCAGCCAGGCGCAGGATTTCCGGTACTACATCGGGCAGCTCTACGTGCACGTCGAGAGC
TACCTGATCGCCTCGGCCTATACGGTGCTGGTGTTCCTCGTGCGGCTGCTGGTGCTGGTCCTGACCTTGC
CGCTGTTCCTGATGGCGGCCTTCACCGGCCTGGTGGACGGGCTCGTGCGCCGCGACGTGCGCGGCTTCGG
CGCCGGGCGCGAATCGGGCTTCGTCTACCACCGGGCGAGAGCCAGCCTGATGCCGCTGGCGGTGCTGCCC
TGGGTCACTTACCTCGCGCTGCCGGTCAGCGTGCATCCGCTGCTGATCCTGCTGCCCAGCGCGGCGCTGC
TCGGCGTCGCGGTGTGCATCGCGTCGGCGACGTTCAAGAAGTACCTGTAG
 Primer design