SecReT4
Protein ID: 330824504
T4SS name [ID]Tfc [739]
Gene symbol-
Locus tagAlide2_1913
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]2015617..2016024 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDF4G6I2
KEGG IDadk:Alide2_1913
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4e-29, Aligned region: 42..118
Protein Sequence: 135 a.a.     [Download]
>gi|330824504|ref|YP_004387807.1| hypothetical protein Alide2_1913 [Alicycliphilus denitrificans K601]
METTRNPAQVRCYAAAALRAVRLAALLLAAAGLQPAIAADGSDNAAEREMLAAVTRQLELLDRLAEHAAT
TAPQERARYHFDYVRLRADLERVRAGVRDYLVPQRAQPRDPVPPAGDYTRSNATTATPGKEATSP
 
Nucleotide Sequence: 408 bp     [Download]
>gi|330822653|ref|NC_015422.1|:2015617-2016024 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGGAAACCACTCGAAACCCTGCGCAGGTCCGCTGCTATGCCGCGGCAGCGCTCCGGGCTGTGCGTCTCG
CGGCGCTGCTGCTTGCCGCTGCCGGATTGCAGCCCGCCATCGCTGCCGATGGCTCCGACAACGCCGCGGA
GCGCGAGATGCTCGCCGCGGTGACGCGCCAGCTCGAACTGCTGGACCGCCTCGCCGAGCACGCCGCCACC
ACAGCGCCGCAGGAGCGCGCCCGCTACCACTTCGACTACGTGCGCCTGCGTGCCGACCTGGAGCGCGTGC
GCGCCGGGGTGCGCGACTACCTCGTTCCACAACGCGCCCAGCCGCGCGATCCTGTGCCGCCGGCCGGCGA
CTACACGCGCAGCAACGCAACCACGGCAACCCCTGGCAAGGAGGCTACGTCGCCATGA
 Primer design