SecReT4
Protein ID: 330824507
T4SS name [ID]Tfc [739]
Gene symbol-
Locus tagAlide2_1916
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]2016672..2017100 [+]
Productconjugative transfer region protein
Component typeTfc11
UniProt IDF4G750
KEGG IDadk:Alide2_1916
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 7.2e-48, Aligned region: 12..131
Protein Sequence: 142 a.a.     [Download]
>gi|330824507|ref|YP_004387810.1| conjugative transfer region protein [Alicycliphilus denitrificans K601]
MAGALESPSRDGLVTFLPHRLNRHPVVVRGLTADELWVCAGLSGAAGLVAGVPLAWLTHSIAMVPTLIVA
GIGVGVFVGGGLLRRWKRGRPDTWLYRQLQWRLALRYPALAAHAGRGQLITRSGWWSTRRLRPDPSLRRG
RP
 
Nucleotide Sequence: 429 bp     [Download]
>gi|330822653|ref|NC_015422.1|:2016672-2017100 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGGCCGGCGCCCTGGAGAGTCCGTCGCGCGACGGGCTCGTGACCTTCCTGCCGCACCGCCTCAACCGCC
ACCCGGTGGTCGTGCGCGGGCTCACGGCCGACGAGCTGTGGGTCTGCGCCGGGCTGTCCGGCGCGGCCGG
TCTCGTGGCCGGCGTGCCGCTGGCCTGGCTGACGCACAGCATCGCGATGGTGCCCACGCTGATCGTCGCC
GGCATCGGTGTCGGTGTCTTCGTGGGCGGCGGCCTGCTGCGGCGGTGGAAGCGCGGCCGGCCCGACACCT
GGCTGTACCGCCAGCTCCAGTGGCGCCTCGCGCTGCGCTACCCCGCGCTGGCTGCGCATGCGGGCCGGGG
CCAGCTCATCACCCGGTCGGGCTGGTGGTCCACGCGGCGCCTGCGGCCCGATCCGTCCCTGCGTCGAGGT
AGACCATGA
 Primer design