SecReT4
Protein ID: 330824546
T4SS name [ID]Tfc [739]
Gene symbol-
Locus tagAlide2_1958
StrainAlicycliphilus denitrificans K601
Repliconchromosome [GenBank: NC_015422] [Browse all T4SS(s) in this replicon]
Location [Strand]2056807..2058207 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDF4G789
KEGG IDadk:Alide2_1958
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 466 a.a.     [Download]
>gi|330824546|ref|YP_004387849.1| integrating conjugative element protein [Alicycliphilus denitrificans K601]
MKTSISRCAQRAKPYTLSVALACAVTAGAGVAWAQTRINPTGVGVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGIGWNSNLICGDMSITTTLQNQLNGITNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNL
LTNGVLQARLDFDRSKLTCKAMANRMADMAGGQAGWDQLAEGFALRDAVSSTDAVSAVEQAESNKGNNGV
PWVGGGNAGGSGQGSIKVVGDVTRAGYNLLNSRGVTDTSSIPRASCGNRLTCQTWSSPQAAADFATRVLG
EREQRTCETCTKTQTTPGVGLTPVIQEEYETKLQALQGLVTGSTPMTVANLETAGSNSLPITRGVIEALR
DEPDQDLLGKRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVKAVDQENTALEQEINNLKTELE
LRRTLAGNSAMAIVQRHGTRAAGSRGIFEGDTTRDRLKEVQKPRNN
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|330822653|ref|NC_015422.1|:2056807-2058207 Alicycliphilus denitrificans K601 chromosome, complete genome
ATGAAAACGTCTATCTCCCGTTGCGCGCAACGCGCCAAGCCCTACACGCTCAGCGTCGCGCTCGCCTGCG
CCGTCACCGCCGGGGCCGGCGTCGCGTGGGCGCAGACCCGCATCAACCCGACCGGCGTCGGCGTGAGCGG
CAGCGTGATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGCGCCGTGTCCATGGGTGGCGCCGGG
AACATGCAGAGCATCGGTGTGGGCATCGGCTGGAACAGCAATCTCATCTGCGGCGACATGAGCATCACGA
CGACGCTGCAGAACCAATTGAACGGCATCACCAACGGCTTCCAGCAGATCATGAGCAACGTGATCCAGAG
CGCGACCAGCGCGGTCGCCTCGCTGCCAGCGCTGATCATCCAGCGCGCCGATCCGGGCCTCTACAACCTG
CTGACCAACGGCGTGCTGCAGGCCCGGCTCGACTTCGACCGCAGCAAGCTGACGTGCAAGGCGATGGCCA
ACCGGATGGCGGACATGGCCGGCGGCCAAGCCGGATGGGATCAGCTCGCCGAAGGCTTCGCGCTGCGCGA
TGCGGTGAGCAGCACCGATGCGGTGTCCGCCGTCGAGCAGGCCGAATCCAACAAGGGCAACAACGGCGTG
CCCTGGGTCGGAGGCGGCAACGCGGGCGGTTCGGGCCAGGGCTCGATCAAGGTGGTCGGCGACGTGACCC
GCGCCGGCTACAACCTGCTCAACAGCCGCGGCGTCACGGACACCTCGTCCATCCCGCGCGCATCCTGCGG
CAACCGGCTGACCTGCCAAACCTGGTCCTCGCCGCAGGCCGCCGCGGACTTCGCGACCCGCGTCCTTGGT
GAGCGCGAGCAACGCACCTGCGAGACCTGCACCAAGACGCAGACGACGCCCGGTGTCGGCCTGACGCCGG
TGATCCAGGAAGAGTACGAGACCAAGCTGCAGGCGCTGCAGGGACTCGTGACCGGCTCGACGCCGATGAC
GGTAGCGAACCTCGAAACCGCCGGCAGCAACTCCCTGCCGATCACGCGCGGCGTGATCGAGGCGCTGCGC
GACGAACCCGATCAAGACCTGCTCGGCAAGCGCCTGGCGTCCGAGGCCGCGCTGTCGAGCGTGCTGGAGA
AGGCCTTGCTGTTGCAGCGCACGCTGCTGACCGGCAAGAAGGAGCCCAACGTCGCCGCCAACGAGCTGGC
CGTGAAGGCGGTCGATCAGGAGAACACTGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAGCTGGAG
CTGCGGCGCACGCTGGCCGGCAATTCGGCGATGGCGATCGTGCAGCGGCACGGCACCCGCGCCGCCGGCT
CGCGCGGCATCTTCGAGGGCGACACCACGCGCGACCGGCTCAAGGAAGTGCAGAAGCCGAGGAACAACTG
A
 Primer design