SecReT4
Protein ID: 330827327
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4751
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]396..2393 [+]
Producttype IV secretion system protein TraD
Component typeTraD_F
UniProt IDF4GGS9
KEGG IDadk:Alide2_4751
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.1e-146, Aligned region: 171..552
TraG-D_C [PF12696], Evalue: 4.4e-23, Aligned region: 411..533
T4SS-DNA_transf [PF02534], Evalue: 1.9e-17, Aligned region: 360..554
AAA_10 [PF12846], Evalue: 1.2e-12, Aligned region: 186..490
Protein Sequence: 665 a.a.     [Download]
>gi|330827327|ref|YP_004390565.1| type IV secretion system protein TraD [Alicycliphilus denitrificans K601]
MAKREEKGSAGSFSRGAELWMHQARLFVVAIWTVVLISILAGLAVTTAYFWNATTADEKYALERNVLAHT
RDALYMTAGKMELNVNGELRKMEVSEVALLTDDMAEDAWRKLRNGGMFGLLTSIGVVFLISLYWWGYGRE
RMQDNQLRGAKLVEGKELARLIRHRDEASPYEIAGVPMRVKSETLHTLFAGAQGTGKSQQFFALMKQVRA
RGKRMIVYDPTGEFTQAFYREGKDILMNPLDSRSPNWNIWNEIAKDYHFDNMANGLIPDPAESDPFWALA
GRMVLKDVIAVLGREGRRTNRDLYNAIAKSNLDAMHALLQGTAGATYVDPTTERTGMSLKMTVQNQLEAF
RFLPDEGESFSIRKWVHEEGDSWMFITAREAMREALKPVLSLWIDTAIKAVLDLEPIHRERLWFCIDELP
TLQKLDILKLALTNTRKYGLCMVLGVQDFSQLYEIYGHDLAKTIISGCQTKLLLRVTDGAAAKLLAELMG
QAEVDEKDETLSYGLSSQRDGVSVMARRQMRDLVLTSEILTLPDMTGYLLVPGDYPIARVKYGYVPTEKQ
ANGFIERDGFAISFKPTTAAAAPAPAPSAAEVQQPAAPEQGDMLDDDDMDAPATVEVMRNENGDVIDKAT
GEIIKPAEKVSRAKDDADAKSAGQGKKPNPLADAL
 
Nucleotide Sequence: 1998 bp     [Download]
>gi|330827325|ref|NC_015423.1|:396-2393 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGGCAAAGAGAGAGGAAAAGGGAAGCGCCGGTAGCTTCTCCCGTGGGGCCGAGTTGTGGATGCACCAAG
CCAGGCTGTTCGTGGTGGCCATCTGGACGGTTGTGCTGATTTCCATCTTGGCCGGTCTGGCAGTCACGAC
GGCGTACTTCTGGAATGCGACTACCGCAGACGAAAAGTACGCGCTGGAGCGGAACGTCTTGGCGCACACG
CGGGATGCGCTCTACATGACGGCCGGAAAGATGGAGCTGAACGTCAACGGCGAGCTGCGCAAGATGGAAG
TTTCCGAGGTTGCCTTGCTGACCGACGACATGGCCGAAGATGCTTGGCGAAAGCTGCGCAACGGCGGCAT
GTTCGGCTTGCTGACTTCCATCGGTGTGGTGTTTCTGATCTCTTTGTACTGGTGGGGCTATGGCCGTGAA
CGGATGCAGGACAACCAACTGCGCGGGGCCAAGCTGGTGGAAGGAAAGGAGCTTGCGCGACTGATCCGAC
ACCGCGACGAGGCAAGCCCTTATGAGATTGCGGGCGTGCCCATGCGCGTGAAGTCAGAGACGCTGCATAC
GCTGTTTGCCGGCGCGCAGGGTACGGGTAAGTCACAGCAGTTTTTCGCACTCATGAAACAGGTGCGGGCG
CGTGGCAAGCGGATGATCGTGTATGACCCGACCGGCGAGTTCACCCAGGCGTTCTACCGTGAAGGCAAAG
ACATCCTGATGAACCCGCTGGACTCCAGAAGCCCGAACTGGAACATCTGGAACGAAATCGCCAAGGACTA
CCACTTCGACAACATGGCGAACGGCCTGATCCCCGATCCGGCCGAGTCCGATCCATTTTGGGCGCTTGCG
GGCCGGATGGTGCTAAAGGACGTGATTGCAGTATTGGGGCGCGAGGGCCGCCGCACGAACCGCGACCTCT
ACAACGCTATCGCCAAGAGCAACCTGGACGCCATGCACGCATTGTTGCAGGGGACAGCGGGCGCAACCTA
TGTTGATCCCACGACCGAGCGCACGGGGATGTCACTCAAGATGACTGTTCAGAACCAGCTTGAAGCCTTC
CGGTTTTTGCCAGATGAGGGCGAATCGTTCTCCATCCGAAAATGGGTACATGAAGAAGGCGATTCATGGA
TGTTCATCACAGCACGGGAAGCGATGCGCGAGGCATTGAAGCCCGTTCTGTCGTTGTGGATCGACACGGC
AATCAAGGCCGTGCTTGACTTGGAGCCGATCCACCGCGAGCGGCTTTGGTTTTGCATTGACGAGCTGCCG
ACACTCCAAAAACTCGACATCCTGAAGCTGGCTCTGACGAACACACGGAAGTACGGTTTGTGCATGGTGC
TGGGCGTGCAGGACTTCAGCCAGCTCTACGAAATCTACGGGCACGATCTGGCCAAGACGATCATTTCCGG
GTGCCAAACGAAGCTGCTGCTGCGTGTGACGGATGGAGCTGCGGCGAAGCTGTTGGCCGAATTGATGGGA
CAGGCCGAGGTGGATGAAAAGGATGAAACCTTGAGCTACGGCCTCAGCTCGCAGCGTGACGGCGTGAGCG
TGATGGCGCGCCGACAGATGCGCGACCTTGTGCTGACATCGGAGATTTTGACGTTGCCCGATATGACCGG
CTATCTGCTGGTTCCGGGCGACTATCCCATTGCCCGCGTCAAGTATGGTTACGTGCCGACAGAGAAACAG
GCCAACGGCTTCATCGAGCGCGACGGCTTTGCGATCAGCTTCAAGCCGACCACGGCGGCCGCAGCGCCGG
CACCCGCTCCGTCCGCCGCTGAAGTTCAGCAGCCGGCCGCGCCGGAGCAAGGCGACATGTTGGATGACGA
CGATATGGACGCGCCGGCTACGGTGGAGGTTATGCGCAACGAAAATGGCGATGTGATCGACAAGGCAACC
GGCGAAATCATCAAGCCAGCCGAGAAGGTTTCGCGCGCGAAAGATGATGCAGATGCGAAATCAGCCGGCC
AGGGCAAGAAGCCCAACCCGCTGGCGGATGCGCTATAG
 Primer design