SecReT4
Protein ID: 330827329
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4753
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]2857..5742 [+]
Productconjugative relaxase domain-containing protein
Component typeTraI_F
UniProt IDF4GGT1
KEGG IDadk:Alide2_4753
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 6.2e-92, Aligned region: 7..296
AAA_30 [PF13604], Evalue: 1.3e-48, Aligned region: 428..605
Viral_helicase1 [PF01443], Evalue: 3.8e-07, Aligned region: 448..573
AAA_19 [PF13245], Evalue: 5.5e-07, Aligned region: 435..497
PIF1 [PF05970], Evalue: 8.3e-07, Aligned region: 432..551
Protein Sequence: 961 a.a.     [Download]
>gi|330827329|ref|YP_004390567.1| conjugative relaxase domain-containing protein [Alicycliphilus denitrificans K601]
MISMNNVGSAGQALHYFSADNYYTQDEGLEHSEWFGKGAEHLGLSGKIDRQAFFEVLNGKVDGQELGKWV
KNEETGEKEREHRPGTDMTFSAPKSVSLMAEVYGKRDVREAHEAAVKKALSHIETELARTRQTVDGKTEA
VQTGNVTVAMFRHNTSRDLDPQTHTHAVIMNATKREDGQWRSLTNEEIYNAQRVIGAIYTSELADRLQAL
GYDIRRTDEKGNFEIAGITREQIEHFSQRRAEIEAALKAKGVDIDDASAQQKEDATLKTRARKVDVDHEA
LIGSWKERAKDIGIDFDAIQAKADAQRAQGGVVRADKLTGREAMSFAAAHLIEREAVVSKNDLMAAAIEH
GAGRVSASEVKRAFDKLEKDGDLVALPDGNYTTKKMLGSEMWALDQVRAQKGQTPKMMEPEAVAARIAQA
EGRQGFKYSEGQKEAISKVLTTEDRYVAVQGLAGTGKTTMLKGVREMAQEQGYTVRGMAPTGAASKVLAR
ETGIATDTVSMFQIKERQLQKDIEFAKQYAPDFQRKAEVWIVDESSFLSQRQKAQLDHMAEKAGAKVVYL
GDTLQLQGVEAGKPFELAQRDGMETAYMTEINRQKTADLKQAVDIITGRDNLGDGQRLTQVELANNARAF
EYMDKAGMIREIPEKSEEDKGRLVAAVVQDILKLDKAERERTIVITAYNEDRRAINAGVREGLKEQGELS
RSEDTREIYTSKGWTRAMQKEAQYYKAGDVVRFGRDYQQIDAKKGEYMRVSAVDAPNGTVVLQKEDGSVI
AWQPKKHNKIEVYDRDTRELAKGDLIRITRNEGEFKNGEVARVTAVAGDKVTLELKQGKDVSLHQVDLSR
NKHWDHAYAQTVHASQGATQHRAIFHIRAPQTESEKKQERALENMAKVFGDRSFYVGATRASHELRIYTN
DKAVAAKAVAAKQDKTSAVETLRQHERATAITADKAGERPVSPQRNGDVQR
 
Nucleotide Sequence: 2886 bp     [Download]
>gi|330827325|ref|NC_015423.1|:2857-5742 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGATTAGCATGAACAACGTGGGCAGCGCCGGGCAGGCACTGCACTACTTTTCCGCTGACAACTACTACA
CCCAGGACGAGGGCTTGGAGCATTCCGAGTGGTTCGGCAAGGGGGCCGAGCACCTTGGGCTTTCCGGCAA
GATTGATCGTCAAGCCTTCTTCGAGGTGTTGAACGGAAAGGTGGATGGCCAAGAGCTGGGCAAGTGGGTC
AAGAACGAGGAAACCGGCGAGAAGGAACGCGAGCACCGGCCGGGCACCGACATGACGTTTTCCGCGCCCA
AGAGTGTTTCTCTCATGGCCGAGGTGTACGGCAAGCGGGACGTGCGGGAGGCGCATGAGGCGGCCGTCAA
GAAGGCACTCAGCCACATCGAAACCGAGCTGGCCAGGACGCGGCAAACCGTGGACGGGAAGACCGAAGCG
GTACAGACCGGCAACGTGACTGTGGCCATGTTCCGGCATAACACAAGCCGCGACCTCGACCCGCAGACGC
ATACGCACGCCGTCATCATGAACGCCACCAAGCGGGAGGATGGGCAGTGGCGCTCCCTGACGAATGAAGA
AATCTACAACGCCCAGCGCGTTATCGGGGCCATCTACACGTCCGAGCTGGCCGACCGGCTCCAGGCGCTG
GGCTACGACATTCGCCGCACCGACGAGAAAGGCAACTTCGAGATTGCCGGTATCACCCGCGAGCAGATCG
AGCACTTCAGCCAGCGCCGGGCAGAAATAGAGGCGGCGCTGAAAGCCAAGGGCGTGGACATCGACGATGC
CAGCGCGCAGCAGAAGGAAGACGCCACGCTGAAGACCAGAGCGCGCAAGGTGGACGTGGATCATGAAGCC
TTGATCGGGAGCTGGAAGGAACGAGCCAAAGACATCGGGATCGACTTCGACGCCATCCAGGCCAAGGCCG
ACGCGCAACGGGCGCAAGGTGGTGTGGTGCGCGCTGACAAGCTCACCGGGCGCGAGGCGATGTCCTTTGC
GGCCGCACACCTGATCGAGCGCGAGGCCGTGGTATCCAAGAACGACCTCATGGCGGCGGCCATCGAGCAC
GGGGCAGGGCGCGTATCGGCATCGGAGGTGAAGCGGGCCTTCGACAAGCTGGAGAAGGATGGTGATCTGG
TGGCCTTGCCTGACGGCAACTACACGACCAAGAAGATGCTGGGCAGCGAAATGTGGGCACTCGACCAAGT
GCGCGCACAGAAGGGCCAGACGCCGAAGATGATGGAGCCGGAAGCGGTGGCAGCGCGGATCGCGCAGGCC
GAGGGCCGGCAGGGCTTCAAATACAGCGAAGGCCAGAAGGAGGCCATCAGCAAGGTACTGACCACTGAAG
ATCGTTACGTGGCGGTGCAGGGCCTTGCCGGGACGGGTAAGACCACTATGCTCAAAGGCGTGCGCGAAAT
GGCGCAGGAGCAGGGCTACACGGTGCGCGGCATGGCTCCGACCGGGGCGGCCAGCAAGGTGCTGGCCAGG
GAGACAGGTATTGCTACTGATACCGTCTCGATGTTCCAGATCAAGGAGCGGCAGCTACAGAAGGACATCG
AGTTTGCCAAGCAGTACGCACCCGACTTCCAGCGCAAGGCGGAAGTCTGGATCGTGGATGAATCGTCCTT
CCTGTCGCAGCGCCAGAAGGCCCAGCTCGACCACATGGCCGAAAAGGCCGGGGCCAAGGTGGTGTACCTG
GGCGACACGCTCCAGTTGCAGGGTGTAGAGGCCGGCAAGCCCTTCGAGCTGGCCCAGCGGGACGGCATGG
AAACCGCGTACATGACCGAAATCAACCGCCAGAAGACCGCCGACCTGAAGCAAGCCGTGGACATCATCAC
TGGCCGCGACAACCTGGGGGACGGCCAGCGGCTCACCCAAGTGGAGCTGGCCAACAACGCGCGGGCCTTC
GAGTACATGGACAAGGCTGGAATGATCCGGGAAATTCCCGAGAAGTCCGAGGAGGACAAGGGCCGCCTGG
TGGCGGCCGTAGTGCAGGACATCTTGAAGCTCGACAAGGCAGAGCGTGAGCGCACCATCGTCATTACCGC
CTATAACGAAGACAGGCGGGCCATCAATGCCGGCGTGCGCGAGGGACTGAAGGAGCAGGGCGAACTGTCG
CGCTCCGAGGATACGCGCGAAATCTACACCTCGAAGGGGTGGACGCGGGCCATGCAGAAGGAGGCGCAAT
ACTACAAGGCCGGCGACGTGGTGCGCTTCGGGCGGGACTACCAGCAGATCGACGCCAAGAAGGGCGAATA
CATGCGCGTGTCGGCCGTGGATGCCCCCAATGGCACTGTGGTGCTCCAGAAGGAAGACGGCTCTGTGATC
GCATGGCAGCCGAAGAAGCACAACAAAATCGAGGTGTACGACCGCGACACCCGCGAGCTGGCCAAGGGCG
ACCTGATCCGTATCACCCGAAACGAAGGCGAGTTCAAAAACGGCGAGGTGGCGCGCGTCACGGCTGTGGC
TGGGGACAAGGTGACGCTGGAGCTGAAGCAAGGCAAGGATGTGTCACTGCACCAAGTGGATCTCTCTCGC
AACAAGCATTGGGATCATGCCTACGCGCAGACGGTTCACGCCTCCCAGGGCGCGACTCAGCACCGGGCCA
TCTTCCACATCCGAGCGCCTCAGACCGAGAGCGAGAAGAAGCAGGAGCGGGCGCTGGAGAACATGGCCAA
GGTCTTCGGGGATCGGAGCTTCTATGTCGGGGCCACGCGCGCCTCGCATGAGCTGCGCATCTACACCAAC
GACAAGGCGGTGGCGGCCAAGGCGGTGGCGGCGAAGCAAGACAAGACCAGTGCGGTGGAAACGCTCCGGC
AACACGAACGGGCCACGGCAATCACGGCCGACAAGGCGGGAGAACGCCCGGTGTCGCCGCAGCGAAACGG
TGACGTTCAACGGTAA
 Primer design