SecReT4
Protein ID: 330827335
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4759
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]9438..9938 [+]
Productlytic transglycosylase catalytic subunit
Component typeOrf169_F
UniProt IDF4GGT7
KEGG IDadk:Alide2_4759
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 166 a.a.     [Download]
>gi|330827335|ref|YP_004390573.1| lytic transglycosylase catalytic subunit [Alicycliphilus denitrificans K601]
MYFSARALIAAASLMMPLAASATCWDEAGRGYGIDPLLLKAIAWKESRGWTGAVGPKLKDGNRALGLMQI
NTIHLPNLARFGIRREHLFDACTSQKVGAWVLADCIQRFGATWKSVGCYYAGPASTNVSAQVEYVRDVQR
FYEGYRRQQAHQISTSPAQVASFQGD
 
Nucleotide Sequence: 501 bp     [Download]
>gi|330827325|ref|NC_015423.1|:9438-9938 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGTACTTCTCTGCACGCGCACTGATCGCGGCGGCATCGCTGATGATGCCGCTCGCTGCTTCTGCAACGT
GCTGGGATGAGGCTGGGCGCGGCTACGGGATCGACCCCTTGCTGTTGAAGGCGATTGCCTGGAAGGAATC
GCGCGGCTGGACGGGTGCAGTCGGCCCGAAGCTGAAAGACGGCAACCGCGCGCTGGGCCTCATGCAGATC
AACACGATCCACCTGCCGAACCTCGCGCGCTTCGGCATCCGCCGTGAACACCTGTTCGACGCTTGCACCT
CGCAGAAGGTGGGGGCCTGGGTTCTGGCCGACTGCATCCAGCGTTTCGGCGCTACCTGGAAGTCCGTGGG
CTGCTACTACGCCGGCCCGGCATCGACCAATGTGAGCGCCCAGGTTGAGTACGTCCGCGACGTGCAGCGG
TTCTACGAGGGCTACCGCAGACAGCAAGCCCACCAAATTTCAACTTCACCGGCCCAAGTGGCCAGTTTCC
AAGGGGATTGA
 Primer design