SecReT4
Protein ID: 330827338
T4SS name [ID]Tra_F [550]
Gene symbol-
Locus tagAlide2_4762
StrainAlicycliphilus denitrificans K601
Repliconplasmid pALIDE201 [GenBank: NC_015423] [Browse all T4SS(s) in this replicon]
Location [Strand]10766..11059 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDF4GGU0
KEGG IDadk:Alide2_4762
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.7e-19, Aligned region: 10..95
Protein Sequence: 97 a.a.     [Download]
>gi|330827338|ref|YP_004390576.1| type IV conjugative transfer system protein TraL [Alicycliphilus denitrificans K601]
MSEKTDLSHYIPRRLDDGAKFLFWEMDVAMIGLMGVLVGIGSGFPVIGLFLGIGAAFFYGKLKAGKHPGM
ATHLLYWFTGFPEPKELPGSHIRELNG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|330827325|ref|NC_015423.1|:10766-11059 Alicycliphilus denitrificans K601 plasmid pALIDE201, complete sequence
ATGTCCGAAAAAACGGATCTCTCTCACTACATCCCGCGCCGATTGGACGACGGAGCCAAATTCCTCTTTT
GGGAAATGGACGTTGCCATGATCGGCCTCATGGGCGTGTTGGTTGGCATTGGCTCAGGCTTCCCGGTGAT
TGGGCTGTTCCTCGGTATTGGAGCGGCCTTTTTCTACGGGAAGCTGAAGGCTGGGAAGCATCCGGGCATG
GCCACCCACCTCCTGTACTGGTTCACCGGGTTTCCCGAGCCGAAAGAGCTGCCGGGTAGCCACATTCGAG
AACTCAATGGATAG
 Primer design